(data stored in ACNUC7421 zone)

EMBL: CP001069.PE435

CP001069.PE435       Location/Qualifiers
FT   CDS             complement(496537..497454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4214"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: rso:RS05428 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4214"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29311"
FT                   /db_xref="GOA:B2UIB0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB0"
FT                   /protein_id="ACD29311.1"
FT                   /translation="MRRAPTSPSTQPADPRVTADASVFGTLARGSRASLERVTNLGDGV
FT                   TAAIWRNEHDEARYIQPGHHTLSVYLQGGYTTHRQDLPHLFGAPGRVCMLPAEHQSSWV
FT                   IEQPMRFVHLYFAPDALAGHAVRLLDAEPRLFTLHDRTFIEDAHLAQACANIAQLDWTD
FT                   LDDRMRANALANDTLSYLVQTQGRTRALAVRGGLAPHVCRRIATRIDAELHLPLSLGQL
FT                   AAEANLSEFHFARMFRASFGAAPHEWVMQQRMARAQMLLRTTTLALATIAERCGFASPS
FT                   HFSRRFALQLGASPSRYRQAWQRG"
     MRRAPTSPST QPADPRVTAD ASVFGTLARG SRASLERVTN LGDGVTAAIW RNEHDEARYI        60
     QPGHHTLSVY LQGGYTTHRQ DLPHLFGAPG RVCMLPAEHQ SSWVIEQPMR FVHLYFAPDA       120
     LAGHAVRLLD AEPRLFTLHD RTFIEDAHLA QACANIAQLD WTDLDDRMRA NALANDTLSY       180
     LVQTQGRTRA LAVRGGLAPH VCRRIATRID AELHLPLSLG QLAAEANLSE FHFARMFRAS       240
     FGAAPHEWVM QQRMARAQML LRTTTLALAT IAERCGFASP SHFSRRFALQ LGASPSRYRQ       300
     AWQRG                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page