(data stored in ACNUC7421 zone)

EMBL: CP001069.PE436

CP001069.PE436       Location/Qualifiers
FT   CDS             complement(497507..497938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4215"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS05430 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4215"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29312"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB1"
FT                   /protein_id="ACD29312.1"
FT                   /translation="MTPFAFAHRVMAGMLAALAALSMPVAGAERWIPLPNQPDSYASLD
FT                   VSSIQRMPSGPVSAWVRVEASNRAGMRSLQRMFGAFRGDMADFLYTVDCRSRQFSVSQA
FT                   KLYQGALTVSERQLANDAGWQRVDGIGLAGEVARQLCGG"
     MTPFAFAHRV MAGMLAALAA LSMPVAGAER WIPLPNQPDS YASLDVSSIQ RMPSGPVSAW        60
     VRVEASNRAG MRSLQRMFGA FRGDMADFLY TVDCRSRQFS VSQAKLYQGA LTVSERQLAN       120
     DAGWQRVDGI GLAGEVARQL CGG                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page