(data stored in SCRATCH zone)

EMBL: CP001069.PE438

CP001069.PE438       Location/Qualifiers
FT   CDS             499011..501761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4217"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: rso:RS05432 hypothetical protein; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4217"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29314"
FT                   /db_xref="GOA:B2UIB3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB3"
FT                   /protein_id="ACD29314.1"
FT                   /translation="MTQFLPAQAGASPADVAPSPEAAQRPVAVTAGAMAEGRNTDFDAL
FT                   SRLSSDAVLLTVDGRLVQANPAAARLLGAQDPAQLAGLQLAGLIHPDDVAQVVPRLAGM
FT                   VSSGVSAQPVEHRLVRADYTHVLVASEAAACEHEGQPAVMLVLREAVSRHALERHAVQA
FT                   RAEALHARRLLASENAVLAQLASNATLSTVLRHLCLYVEQVYPNAMSALLLLDAGSQTL
FT                   RVAAAPTLPAAYAATLENSPVGPEAGACGCAMYLGDTVFIDSIATDPRWQRERTAALAA
FT                   GFASAWALPIRSSRGDKLGVLALFYRQPCMPVEEEQHFLDDVTHLAGVAIQKDNVERGL
FT                   AESEERYRLAISNLHEGVVIISPDGVVQAANASAERILRVRPGQLVGRNRLDPIQRVVD
FT                   EYGKEIGSTMMPSGQVLRTGEPIFGRVYGLLLKTGELMWVRQNIIPIRRHAEPTPSSVM
FT                   LSFADITDIKRAEQRLRHLAAHDALTGLTNRSFFIAHLESAIESARDESRELALFFLDL
FT                   DRFKSVNDTAGHACGDTLLQSAAARLTDCIGPGDVIARLGGDEFVILIDQRVEGKRIAL
FT                   LAERLLQAMREPFDTVNGRYYLGVSIGVALYPHDGISGSDLLRSADAAMYRAKQNGRNR
FT                   AQFYTAELNARLQRRYMLENALRDARENNELQLVYQPKYDLASHRIVGAEALLRWNSAK
FT                   LGAISPVEFIPVAEETGLIVPIGAWVLRRACEQAVIWYEALGYDFRMAVNLSARQFQAG
FT                   DVVPMIEQTLADSGLPPTALEVEITESLLMGGADEVRPMFDALTAQGIRISIDDFGTGY
FT                   SSLSYLQRFPISNVKIDRSFITGIPHDPDSVALTEAIVAMARALGMTVTAEGVEDADQV
FT                   EFLAKAGCQEIQGYYIGKPVTAEGFDRLLRAHLSVVDAGVRAALG"
     MTQFLPAQAG ASPADVAPSP EAAQRPVAVT AGAMAEGRNT DFDALSRLSS DAVLLTVDGR        60
     LVQANPAAAR LLGAQDPAQL AGLQLAGLIH PDDVAQVVPR LAGMVSSGVS AQPVEHRLVR       120
     ADYTHVLVAS EAAACEHEGQ PAVMLVLREA VSRHALERHA VQARAEALHA RRLLASENAV       180
     LAQLASNATL STVLRHLCLY VEQVYPNAMS ALLLLDAGSQ TLRVAAAPTL PAAYAATLEN       240
     SPVGPEAGAC GCAMYLGDTV FIDSIATDPR WQRERTAALA AGFASAWALP IRSSRGDKLG       300
     VLALFYRQPC MPVEEEQHFL DDVTHLAGVA IQKDNVERGL AESEERYRLA ISNLHEGVVI       360
     ISPDGVVQAA NASAERILRV RPGQLVGRNR LDPIQRVVDE YGKEIGSTMM PSGQVLRTGE       420
     PIFGRVYGLL LKTGELMWVR QNIIPIRRHA EPTPSSVMLS FADITDIKRA EQRLRHLAAH       480
     DALTGLTNRS FFIAHLESAI ESARDESREL ALFFLDLDRF KSVNDTAGHA CGDTLLQSAA       540
     ARLTDCIGPG DVIARLGGDE FVILIDQRVE GKRIALLAER LLQAMREPFD TVNGRYYLGV       600
     SIGVALYPHD GISGSDLLRS ADAAMYRAKQ NGRNRAQFYT AELNARLQRR YMLENALRDA       660
     RENNELQLVY QPKYDLASHR IVGAEALLRW NSAKLGAISP VEFIPVAEET GLIVPIGAWV       720
     LRRACEQAVI WYEALGYDFR MAVNLSARQF QAGDVVPMIE QTLADSGLPP TALEVEITES       780
     LLMGGADEVR PMFDALTAQG IRISIDDFGT GYSSLSYLQR FPISNVKIDR SFITGIPHDP       840
     DSVALTEAIV AMARALGMTV TAEGVEDADQ VEFLAKAGCQ EIQGYYIGKP VTAEGFDRLL       900
     RAHLSVVDAG VRAALG                                                       916
//

If you have problems or comments...

PBIL Back to PBIL home page