(data stored in SCRATCH zone)

EMBL: CP001069.PE44

CP001069.PE44        Location/Qualifiers
FT   CDS             complement(50377..50523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3804"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS01993 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3804"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28920"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH69"
FT                   /protein_id="ACD28920.1"
FT                   /translation="MNTVALQAAPASRLARFWQILRREASRAVALHVESCGMMAELYRR
FT                   SGH"
     MNTVALQAAP ASRLARFWQI LRREASRAVA LHVESCGMMA ELYRRSGH                     48
//

If you have problems or comments...

PBIL Back to PBIL home page