(data stored in ACNUC7421 zone)

EMBL: CP001069.PE440

CP001069.PE440       Location/Qualifiers
FT   CDS             502447..503259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4219"
FT                   /product="transcriptional regulator, ModE family"
FT                   /note="TIGRFAM: molybdate transport repressor, ModE; PFAM:
FT                   regulatory protein LysR; TOBE domain protein; KEGG:
FT                   rso:RS05434 putative molybdenum-pterin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4219"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29316"
FT                   /db_xref="GOA:B2UIB5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR003725"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB5"
FT                   /protein_id="ACD29316.1"
FT                   /translation="MLELDGTIWLRAGEDNWGGRGRIELLAAIGQTGSITAGAKAVGLS
FT                   YKAAWDAIDTMNNLAGEPLVVRTTGGKGGGGSVLTPRAQRLIESFRVLEAEHRRFVERL
FT                   DAAAQAASEDVHLLRRLMLRTSARNTLFGTVESVAPGAVNDVVTLRLPGGQAVAATITQ
FT                   ESTRVLGLAPGVQAVALIKAPAVMLMRGAGEWRVSAENQLPCVVTEIRDGAVQAEVRLR
FT                   LLDVSDPSAAETVLVAMLSRTAVQTLALAEGVEAVAVFEASSVILGLA"
     MLELDGTIWL RAGEDNWGGR GRIELLAAIG QTGSITAGAK AVGLSYKAAW DAIDTMNNLA        60
     GEPLVVRTTG GKGGGGSVLT PRAQRLIESF RVLEAEHRRF VERLDAAAQA ASEDVHLLRR       120
     LMLRTSARNT LFGTVESVAP GAVNDVVTLR LPGGQAVAAT ITQESTRVLG LAPGVQAVAL       180
     IKAPAVMLMR GAGEWRVSAE NQLPCVVTEI RDGAVQAEVR LRLLDVSDPS AAETVLVAML       240
     SRTAVQTLAL AEGVEAVAVF EASSVILGLA                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page