(data stored in ACNUC7421 zone)

EMBL: CP001069.PE443

CP001069.PE443       Location/Qualifiers
FT   CDS             complement(504507..505193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4222"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rso:RS05467 probable
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4222"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29319"
FT                   /db_xref="GOA:B2UIB8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIB8"
FT                   /protein_id="ACD29319.1"
FT                   /translation="MSASIWTPLLLSLKVAGWATVLNLVLGVGAAYALARTRSRLREVI
FT                   DSVLTLPLVLPPTVLGYYLLVLLGRRGTIGGWLDSMGIQLVFTWQGAVIASTVVAFPLV
FT                   MKSARAAFEGVDHQLENAARVLGLPEAAVFFRVTLPLAARGIAAGVLLAFARALGEFGA
FT                   TLMIAGNLPGRTQTLSVAIYEAVQAGDDATANTLVLITSVTCIVVLVVASRLLQGRAPS
FT                   LQEQLA"
     MSASIWTPLL LSLKVAGWAT VLNLVLGVGA AYALARTRSR LREVIDSVLT LPLVLPPTVL        60
     GYYLLVLLGR RGTIGGWLDS MGIQLVFTWQ GAVIASTVVA FPLVMKSARA AFEGVDHQLE       120
     NAARVLGLPE AAVFFRVTLP LAARGIAAGV LLAFARALGE FGATLMIAGN LPGRTQTLSV       180
     AIYEAVQAGD DATANTLVLI TSVTCIVVLV VASRLLQGRA PSLQEQLA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page