(data stored in SCRATCH zone)

EMBL: CP001069.PE446

CP001069.PE446       Location/Qualifiers
FT   CDS             complement(510280..511590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4225"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rso:RSp1112 probable transmembrane multidrug efflux system
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4225"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29322"
FT                   /db_xref="GOA:B2UIC1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC1"
FT                   /protein_id="ACD29322.1"
FT                   /translation="MSLSKRTLAISVAAVLGVAAVGTYGLVSSAGASQQPAAAPAATPV
FT                   DVAPVLAKNVSEWDEFSGRIEAVQRVEVRPLVSGTVTAVHFKDGSIVKKGDALFTIDPR
FT                   PYAAEVARTQAALTAAKSRVAYTTSELDRAQKLVADNAIARREFEEKENAAREAQANLQ
FT                   GAAAALEAARLNLEYTHIVAPVAGRVSRAEITVGNVVSAGGAAPVLTTLVSVSPMYVAF
FT                   DADEQSYLRYSAKAAQGAKTPVYIGLANEDGYTREGAIQSVDNRLDVRSGTIRVRATLD
FT                   NADGRLTPGLYARVRMSTGAPHDAILITDKAIGTDQDKKFVLVVDAANKTSYRPVVLGA
FT                   SIDGLRVVKSGLKAGERIVVNGIQRVRPGDAVAPNTVTMDSLVTKRVVLPGAQPEAPAA
FT                   PAEAKADTTTAPAAKAEAKAANAKTAATAQRLPADRA"
     MSLSKRTLAI SVAAVLGVAA VGTYGLVSSA GASQQPAAAP AATPVDVAPV LAKNVSEWDE        60
     FSGRIEAVQR VEVRPLVSGT VTAVHFKDGS IVKKGDALFT IDPRPYAAEV ARTQAALTAA       120
     KSRVAYTTSE LDRAQKLVAD NAIARREFEE KENAAREAQA NLQGAAAALE AARLNLEYTH       180
     IVAPVAGRVS RAEITVGNVV SAGGAAPVLT TLVSVSPMYV AFDADEQSYL RYSAKAAQGA       240
     KTPVYIGLAN EDGYTREGAI QSVDNRLDVR SGTIRVRATL DNADGRLTPG LYARVRMSTG       300
     APHDAILITD KAIGTDQDKK FVLVVDAANK TSYRPVVLGA SIDGLRVVKS GLKAGERIVV       360
     NGIQRVRPGD AVAPNTVTMD SLVTKRVVLP GAQPEAPAAP AEAKADTTTA PAAKAEAKAA       420
     NAKTAATAQR LPADRA                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page