(data stored in SCRATCH zone)

EMBL: CP001069.PE447

CP001069.PE447       Location/Qualifiers
FT   CDS             complement(511706..512797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4226"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: rso:RS02619 probable lipase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4226"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29323"
FT                   /db_xref="GOA:B2UIC2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC2"
FT                   /protein_id="ACD29323.1"
FT                   /translation="MGSSPPRLVVSDRSLPSDAASAAVRPAQPYATPAPTNVALNNKLR
FT                   GAASTLPKQASACKETAGAAPLPREVTAEDYWTQGYAGRIRLRVFRPEMHADDAAAPLR
FT                   RPGVLYLHGGGFVRGSIDDADAPGRYLAATLPAVVVTVGYSLAPAAPFPAAPEDVYAAL
FT                   CCMADHADAWGIDRRRIAVAGHDAGGNLSAALTMIARDRGGPNLRAQVLIAPMLDPTMA
FT                   RVRPDHLANADNSAEVCADCYRQYLPRPTERVHPYAAPVESRRLQGLPPALLLTAPQDL
FT                   LRTEAERYAACLIEAGVVTQVVRVNEACHDSIAMSAVAQDEMTCFLRWHLGMTRQTAAP
FT                   RKRRPRADRKDRTSIDPTGETPG"
     MGSSPPRLVV SDRSLPSDAA SAAVRPAQPY ATPAPTNVAL NNKLRGAAST LPKQASACKE        60
     TAGAAPLPRE VTAEDYWTQG YAGRIRLRVF RPEMHADDAA APLRRPGVLY LHGGGFVRGS       120
     IDDADAPGRY LAATLPAVVV TVGYSLAPAA PFPAAPEDVY AALCCMADHA DAWGIDRRRI       180
     AVAGHDAGGN LSAALTMIAR DRGGPNLRAQ VLIAPMLDPT MARVRPDHLA NADNSAEVCA       240
     DCYRQYLPRP TERVHPYAAP VESRRLQGLP PALLLTAPQD LLRTEAERYA ACLIEAGVVT       300
     QVVRVNEACH DSIAMSAVAQ DEMTCFLRWH LGMTRQTAAP RKRRPRADRK DRTSIDPTGE       360
     TPG                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page