(data stored in SCRATCH zone)

EMBL: CP001069.PE448

CP001069.PE448       Location/Qualifiers
FT   CDS             513138..514082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4227"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RS02618 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4227"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29324"
FT                   /db_xref="GOA:B2UIC3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC3"
FT                   /protein_id="ACD29324.1"
FT                   /translation="MDRLQAMQVFTRVVEASSFTKAADSLQLPRATVTNLVQSLEAHLG
FT                   VRLLHRTTRRVNVTADGAAYYERCVRLLGDLEETEAAFSQSSSGARGTLRIDVPASIGK
FT                   RLLVPRIRDFHEAYPDLQLEIGMSDRTVDLVQEGVDCAVRGGELQDSSLVARRIGQLSM
FT                   VNCASPEYLARCGTPKTLEDLQDHTAVNYFSARNGRRMDWDFVIDGQKQIHKVRSMVSV
FT                   NDAESAVACGLHGLGLLQTSRFLVYEHLMSGALVEVLPDHISEAVPVSVVYPHNRHLSP
FT                   KVRVFVDWVATLFADHPCLQLKENPRLHIVSAA"
     MDRLQAMQVF TRVVEASSFT KAADSLQLPR ATVTNLVQSL EAHLGVRLLH RTTRRVNVTA        60
     DGAAYYERCV RLLGDLEETE AAFSQSSSGA RGTLRIDVPA SIGKRLLVPR IRDFHEAYPD       120
     LQLEIGMSDR TVDLVQEGVD CAVRGGELQD SSLVARRIGQ LSMVNCASPE YLARCGTPKT       180
     LEDLQDHTAV NYFSARNGRR MDWDFVIDGQ KQIHKVRSMV SVNDAESAVA CGLHGLGLLQ       240
     TSRFLVYEHL MSGALVEVLP DHISEAVPVS VVYPHNRHLS PKVRVFVDWV ATLFADHPCL       300
     QLKENPRLHI VSAA                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page