(data stored in ACNUC7421 zone)

EMBL: CP001069.PE452

CP001069.PE452       Location/Qualifiers
FT   CDS             complement(516790..517590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4231"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /EC_number="3.1.3.12"
FT                   /note="KEGG: rso:RSp1104 probable trehalose-phosphatase
FT                   protein; TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: trehalose-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4231"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29328"
FT                   /db_xref="GOA:B2UIC7"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIC7"
FT                   /protein_id="ACD29328.1"
FT                   /translation="MSKNVSPQSSANAAPLPSLDLGRTAFLLDFDGTLVDIAPQPEAVH
FT                   VSAPLRETLAALHAASGGALAIISGRTVHDVESRLSLPGLVIAGVHGAERRYADGGFVR
FT                   LNADADALAQLERELRAELTQLSTQFSGVVLESKGIAFALHYRHAPEAENAVLTVADRL
FT                   ARRYADHVRLQAGKMVAELKPRGASKGDVVHTLMTEPPFMGRTALFAGDDLTDESAFDA
FT                   VNALEGWSIKVGTGPSQARWRVQDAAALRAWLATLTAPSKRGAA"
     MSKNVSPQSS ANAAPLPSLD LGRTAFLLDF DGTLVDIAPQ PEAVHVSAPL RETLAALHAA        60
     SGGALAIISG RTVHDVESRL SLPGLVIAGV HGAERRYADG GFVRLNADAD ALAQLERELR       120
     AELTQLSTQF SGVVLESKGI AFALHYRHAP EAENAVLTVA DRLARRYADH VRLQAGKMVA       180
     ELKPRGASKG DVVHTLMTEP PFMGRTALFA GDDLTDESAF DAVNALEGWS IKVGTGPSQA       240
     RWRVQDAAAL RAWLATLTAP SKRGAA                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page