(data stored in ACNUC7421 zone)

EMBL: CP001069.PE46

CP001069.PE46        Location/Qualifiers
FT   CDS             complement(53176..53805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3806"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bch:Bcen2424_3720 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3806"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28922"
FT                   /db_xref="GOA:B2UH71"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH71"
FT                   /protein_id="ACD28922.1"
FT                   /translation="MPSSPMPIETGRRERKRSQTLDHLAATAFALFEAHGYDAVTMEQI
FT                   AAQADVSKGTLYNHFPVKEALLAHQFHAELAAGGMQLRAQIEAQPDFASRMAVLLSASA
FT                   DWCQARRPYLAAYFRYRFASADLASRNRDADKRSGLEAVFAMLIDAGQRSGELDAQLDA
FT                   EHLAGLFEYLYLGALMRWLARPDTDLHEGFSVIIDLFLRGIGRTEA"
     MPSSPMPIET GRRERKRSQT LDHLAATAFA LFEAHGYDAV TMEQIAAQAD VSKGTLYNHF        60
     PVKEALLAHQ FHAELAAGGM QLRAQIEAQP DFASRMAVLL SASADWCQAR RPYLAAYFRY       120
     RFASADLASR NRDADKRSGL EAVFAMLIDA GQRSGELDAQ LDAEHLAGLF EYLYLGALMR       180
     WLARPDTDLH EGFSVIIDLF LRGIGRTEA                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page