(data stored in ACNUC7421 zone)

EMBL: CP001069.PE462

CP001069.PE462       Location/Qualifiers
FT   CDS             complement(530185..531930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4241"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein ShlB-type; KEGG: rso:RS02601 probable
FT                   activation/secretion signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4241"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29338"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="UniProtKB/TrEMBL:B2UID7"
FT                   /protein_id="ACD29338.1"
FT                   /translation="MERAAARLRDTTNEITEETGVRTTTMRLALATGVALTGPALSWAQ
FT                   SSPTQGNPIDTLPKVDTSRPPQQKIQVEVQRPNPALENLLATHLTPTKFQIEGVKTLPF
FT                   PEVAAHFAPLAGHDVTVAQLLQAANDVTKLYADRGFPLSFAFVPAQTFEGGVVRVTVVE
FT                   GYVARMRIEGTPGPLADRLREISQRLMNEKPLRRETFERVTGVLALQPGVQITATVQPP
FT                   TTTDGASELVLNVKRQPYTIGTGIEYRSPGVRAIITGTLNSVTPLGEQITVSTLQPRGS
FT                   DHETFYSASWAQPIGTDGLLAKLTWSHYRGMPENLPLEQLGYQSRYLTDTQRLGLSLSY
FT                   PVLLSNTRNLMVTGTFYGNDDKQRYNPQVTTLPQTELDTKVRVAGAEVLYTEINPGETR
FT                   RASLGLYQGINSLGAGKAASSNAKNDVDLSFLRTRVTASEAHDLPLGFGVVVSGAAQYS
FT                   GAVLPSSEQISFGGRFFGLAYPAGEVAGDRGWGASVEINRAFQVSMDYLKTVQPYLLYD
FT                   TAKVYSNAGTLVHDQLGSIALGVRFSDRKYYTLDLAIARPVGDKPINSSSRSLRFNAAY
FT                   TYQFN"
     MERAAARLRD TTNEITEETG VRTTTMRLAL ATGVALTGPA LSWAQSSPTQ GNPIDTLPKV        60
     DTSRPPQQKI QVEVQRPNPA LENLLATHLT PTKFQIEGVK TLPFPEVAAH FAPLAGHDVT       120
     VAQLLQAAND VTKLYADRGF PLSFAFVPAQ TFEGGVVRVT VVEGYVARMR IEGTPGPLAD       180
     RLREISQRLM NEKPLRRETF ERVTGVLALQ PGVQITATVQ PPTTTDGASE LVLNVKRQPY       240
     TIGTGIEYRS PGVRAIITGT LNSVTPLGEQ ITVSTLQPRG SDHETFYSAS WAQPIGTDGL       300
     LAKLTWSHYR GMPENLPLEQ LGYQSRYLTD TQRLGLSLSY PVLLSNTRNL MVTGTFYGND       360
     DKQRYNPQVT TLPQTELDTK VRVAGAEVLY TEINPGETRR ASLGLYQGIN SLGAGKAASS       420
     NAKNDVDLSF LRTRVTASEA HDLPLGFGVV VSGAAQYSGA VLPSSEQISF GGRFFGLAYP       480
     AGEVAGDRGW GASVEINRAF QVSMDYLKTV QPYLLYDTAK VYSNAGTLVH DQLGSIALGV       540
     RFSDRKYYTL DLAIARPVGD KPINSSSRSL RFNAAYTYQF N                           581
//

If you have problems or comments...

PBIL Back to PBIL home page