(data stored in SCRATCH zone)

EMBL: CP001069.PE467

CP001069.PE467       Location/Qualifiers
FT   CDS             536596..537099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4246"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: rso:RS02595
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4246"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29343"
FT                   /db_xref="GOA:B2UIE2"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE2"
FT                   /protein_id="ACD29343.1"
FT                   /translation="MPTLQREREGARMHPEVRTHAVRRPRRHGGRGAASVEFAIVVPVL
FT                   LVLMLGVVYYGVILAMQQALTLAAEEGARAALRYQPSNTQRVAAAYAAVTSVLPTFLTG
FT                   RVQTNQSSTPLVNCQNVAGMQCLSVVLTLPVTSGNNPLLPSIPLLPAPATLTGSAVVQL
FT                   VPGS"
     MPTLQREREG ARMHPEVRTH AVRRPRRHGG RGAASVEFAI VVPVLLVLML GVVYYGVILA        60
     MQQALTLAAE EGARAALRYQ PSNTQRVAAA YAAVTSVLPT FLTGRVQTNQ SSTPLVNCQN       120
     VAGMQCLSVV LTLPVTSGNN PLLPSIPLLP APATLTGSAV VQLVPGS                     167
//

If you have problems or comments...

PBIL Back to PBIL home page