(data stored in ACNUC7421 zone)

EMBL: CP001069.PE469

CP001069.PE469       Location/Qualifiers
FT   CDS             538068..539432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4248"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   KEGG: rso:RS02594 probable outer membrane channel signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4248"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29345"
FT                   /db_xref="GOA:B2UIE4"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE4"
FT                   /protein_id="ACD29345.1"
FT                   /translation="MTDAAMVRGWMGGLALGCAAFVSSAFAETAPTGQTLHLLTGSQRE
FT                   IRLGKPLERIAIGNPEIADALLLKGRGTATSVLIIAKKPGAANVMVWTQGGVATTYNVQ
FT                   VDAAAPVPGDPAVVAQGDTAVVSGQPKDVYALARARRSAAAASGAEKPKDGNVIDTTSM
FT                   NVPGTVQVDVRVVEFSKTVLKEAGFTFGRTRGGFDFRTFAPSSLSKVTFGSNGLSTEST
FT                   MPIGSAFNLLVSSVSKGLFADLSLLESNGMARVLAEPSLVALSGQSANFLAGGEIPIPV
FT                   PQALGTTTIEYKPFGIGLTVSPTILSENRIALKVAPEASDLDFSRGVTLNGATVPAIVT
FT                   RRADTTVELGDGESFVIGGLVSRSTLSNVDKVPFLGDVPIIGTFFKRLNYNQEERELVI
FT                   IVTPHLVKPMARNAPIDKMLPGQSSGRDRDTAGDPVWRPFALGVADPAAMPGFSK"
     MTDAAMVRGW MGGLALGCAA FVSSAFAETA PTGQTLHLLT GSQREIRLGK PLERIAIGNP        60
     EIADALLLKG RGTATSVLII AKKPGAANVM VWTQGGVATT YNVQVDAAAP VPGDPAVVAQ       120
     GDTAVVSGQP KDVYALARAR RSAAAASGAE KPKDGNVIDT TSMNVPGTVQ VDVRVVEFSK       180
     TVLKEAGFTF GRTRGGFDFR TFAPSSLSKV TFGSNGLSTE STMPIGSAFN LLVSSVSKGL       240
     FADLSLLESN GMARVLAEPS LVALSGQSAN FLAGGEIPIP VPQALGTTTI EYKPFGIGLT       300
     VSPTILSENR IALKVAPEAS DLDFSRGVTL NGATVPAIVT RRADTTVELG DGESFVIGGL       360
     VSRSTLSNVD KVPFLGDVPI IGTFFKRLNY NQEERELVII VTPHLVKPMA RNAPIDKMLP       420
     GQSSGRDRDT AGDPVWRPFA LGVADPAAMP GFSK                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page