(data stored in ACNUC7421 zone)

EMBL: CP001069.PE471

CP001069.PE471       Location/Qualifiers
FT   CDS             540782..542137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4250"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   rso:RSp1085 probable secretion ATPase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4250"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29347"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE6"
FT                   /protein_id="ACD29347.1"
FT                   /translation="MTQPIEFSNQADAGNGAFAVSQAFQDIKEAAHEHLLTRIEELGAE
FT                   FGRWSRTAIQRFVDLEVEGFTRMRRIPVNETEIRQIAEALTKELAGFGPIEDLLADPAV
FT                   EDILVNGHLDVYVSRHGILERIPVRFADNNHLLRIVRRILAPIGRRLDESNPMVDARLP
FT                   DGGRINVVIPPLALEGPVVSIRKFRKDPLKPEDLLGLGTMSEEIGALIDSAVRARCNIL
FT                   VSGGTSSGKTSLLNAMAYHIPTTERVITIEDTAELSLNHPHVVRLESRPGGFEGTGVVT
FT                   IRELLRNSLRMRPDRIIVGEVRGGEVLEMLQAMSTGHDGSMGTIHASSPRECLYRLEML
FT                   AGFAGFQGSEVSLRRQITNAIDFIVQIGRLSNGKRRILSITEVTGLGDNIISTQELYRY
FT                   EPYVGPDGEEVDRWTALGLQPHSPKLARMRNSEGGGMDGGMTGFGGGGRFHV"
     MTQPIEFSNQ ADAGNGAFAV SQAFQDIKEA AHEHLLTRIE ELGAEFGRWS RTAIQRFVDL        60
     EVEGFTRMRR IPVNETEIRQ IAEALTKELA GFGPIEDLLA DPAVEDILVN GHLDVYVSRH       120
     GILERIPVRF ADNNHLLRIV RRILAPIGRR LDESNPMVDA RLPDGGRINV VIPPLALEGP       180
     VVSIRKFRKD PLKPEDLLGL GTMSEEIGAL IDSAVRARCN ILVSGGTSSG KTSLLNAMAY       240
     HIPTTERVIT IEDTAELSLN HPHVVRLESR PGGFEGTGVV TIRELLRNSL RMRPDRIIVG       300
     EVRGGEVLEM LQAMSTGHDG SMGTIHASSP RECLYRLEML AGFAGFQGSE VSLRRQITNA       360
     IDFIVQIGRL SNGKRRILSI TEVTGLGDNI ISTQELYRYE PYVGPDGEEV DRWTALGLQP       420
     HSPKLARMRN SEGGGMDGGM TGFGGGGRFH V                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page