(data stored in ACNUC7421 zone)

EMBL: CP001069.PE473

CP001069.PE473       Location/Qualifiers
FT   CDS             543066..544055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4252"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   rso:RS02590 putative tight adherence TadC related
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4252"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29349"
FT                   /db_xref="GOA:B2UIE8"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE8"
FT                   /protein_id="ACD29349.1"
FT                   /translation="MDDTLITLSLTAAAAGVLVFGGLALRATLTRHRSARKLDTALSDM
FT                   RATAANPAAPAASPVVPPAARPRPHGSREAQQLQQQIAKVGQRWIDTGLGRRIVTEEDR
FT                   KLLEECGYYGEHARTVFGGTRILLPPLLAVFGALHASSALFVFVFGFVGFALGYLAPKW
FT                   LLGRRKESRRRRMDDELPVMVDMLRLLQGVGLSIDQSLQVIANEFHGMLPVLAGEFGRA
FT                   NQQFASGRSREQTLLRIARLFDNEDLKGLITLLTQVDRFGGAVQEPLRQFGGRLQENRR
FT                   ARLKERVGKLTVQMTMIMVMTLLPALLIITAGPGFMGVMRSLQQTGGH"
     MDDTLITLSL TAAAAGVLVF GGLALRATLT RHRSARKLDT ALSDMRATAA NPAAPAASPV        60
     VPPAARPRPH GSREAQQLQQ QIAKVGQRWI DTGLGRRIVT EEDRKLLEEC GYYGEHARTV       120
     FGGTRILLPP LLAVFGALHA SSALFVFVFG FVGFALGYLA PKWLLGRRKE SRRRRMDDEL       180
     PVMVDMLRLL QGVGLSIDQS LQVIANEFHG MLPVLAGEFG RANQQFASGR SREQTLLRIA       240
     RLFDNEDLKG LITLLTQVDR FGGAVQEPLR QFGGRLQENR RARLKERVGK LTVQMTMIMV       300
     MTLLPALLII TAGPGFMGVM RSLQQTGGH                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page