(data stored in ACNUC7421 zone)

EMBL: CP001069.PE474

CP001069.PE474       Location/Qualifiers
FT   CDS             544057..544980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4253"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   rso:RS02589 probable lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4253"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29350"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016931"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIE9"
FT                   /protein_id="ACD29350.1"
FT                   /translation="MTRFPNAVRAALAGMTMLTVMLAGCGSMATSDMSLRADADIEMAR
FT                   QRQSQEKSEITSPATYLSLIRRMQEQGLYYASLAHIDAYQQRYGRAPEIMLLRADALRE
FT                   TDQLAAADAEYRAVVGATSAMGAGTQGGLLNAAAWRGLGIIAGRQGNFTEAARRLQVAA
FT                   QANPTDASTASDLGYALMRAGEVEQARVPLMQAQQMAASSPKIAGNLVIWLTVNDRKDD
FT                   AASLASHAQLTASARKAIDEDVARVRGAWRDRRIGRDAAAAATRAVALSPSAAGVAGTA
FT                   TPAITTQSRPLALQRGRLLDTLETAQ"
     MTRFPNAVRA ALAGMTMLTV MLAGCGSMAT SDMSLRADAD IEMARQRQSQ EKSEITSPAT        60
     YLSLIRRMQE QGLYYASLAH IDAYQQRYGR APEIMLLRAD ALRETDQLAA ADAEYRAVVG       120
     ATSAMGAGTQ GGLLNAAAWR GLGIIAGRQG NFTEAARRLQ VAAQANPTDA STASDLGYAL       180
     MRAGEVEQAR VPLMQAQQMA ASSPKIAGNL VIWLTVNDRK DDAASLASHA QLTASARKAI       240
     DEDVARVRGA WRDRRIGRDA AAAATRAVAL SPSAAGVAGT ATPAITTQSR PLALQRGRLL       300
     DTLETAQ                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page