(data stored in SCRATCH zone)

EMBL: CP001069.PE475

CP001069.PE475       Location/Qualifiers
FT   CDS             544977..545306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4254"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS02588 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4254"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29351"
FT                   /db_xref="InterPro:IPR022053"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF0"
FT                   /protein_id="ACD29351.1"
FT                   /translation="MIPRILMAAGMAVWLMSNPAGAQGFSGGNPQNATQAAPNVGSNMG
FT                   DATRALLKAQRDGTYAGEFVPLRGEQAALAYQRYLDSFSRPMPGLSQTAPSAKSTSSSQ
FT                   ATTAR"
     MIPRILMAAG MAVWLMSNPA GAQGFSGGNP QNATQAAPNV GSNMGDATRA LLKAQRDGTY        60
     AGEFVPLRGE QAALAYQRYL DSFSRPMPGL SQTAPSAKST SSSQATTAR                   109
//

If you have problems or comments...

PBIL Back to PBIL home page