(data stored in ACNUC7421 zone)

EMBL: CP001069.PE476

CP001069.PE476       Location/Qualifiers
FT   CDS             545398..547056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4255"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS02587 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4255"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29352"
FT                   /db_xref="GOA:B2UIF1"
FT                   /db_xref="InterPro:IPR018705"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF1"
FT                   /protein_id="ACD29352.1"
FT                   /translation="MTATFIATVGLAVLVSIDIGNLFYTQRALQRSADLAAMAAAQRLD
FT                   LPAAAQQAVIQNGLTVDGTNVTLAVVPGVWDASAGTAPTYFTAQAAVDGNTNAAQVTIT
FT                   QNVPYFFMVGQRRLQATAIAKNTSIVAFSLGSGLASVDNGLLNQLLGYLLHTNLNIDAV
FT                   SYQGLATTNIRLADLAVALGAGSMQQLLSLSPSLGSLFNAVISVASQSGLAGVSVGGAG
FT                   ASNALSFGSDLNVPINIGDGGASSPGLLQVLALAGNEQAALNATVNVLDLLTTAAQIAN
FT                   SQSAVNVAPVKLNLLGLGAVTLSLKIIEPPAIAVGPPGQFLSGPSAGQWKTQARTAQVR
FT                   LGVGVLVGAPGVLAVSVPIGLQVAAAQAHAKSNSCTVPRASSSATISAQPQPVSICIAT
FT                   DADKAVNGSMDCASASPAGLVDLGPLGAVSIKANVSPIANSNWGDETIAATQIGLNPQT
FT                   DTSGKSPPRVATQAVFSSILNSNLNQLQLTVTLPLGGTVQLGSDLAPVIAPVLALVGTT
FT                   LDAVLSPLLGVLGIQLGYADIKLLSLDCDAVELVY"
     MTATFIATVG LAVLVSIDIG NLFYTQRALQ RSADLAAMAA AQRLDLPAAA QQAVIQNGLT        60
     VDGTNVTLAV VPGVWDASAG TAPTYFTAQA AVDGNTNAAQ VTITQNVPYF FMVGQRRLQA       120
     TAIAKNTSIV AFSLGSGLAS VDNGLLNQLL GYLLHTNLNI DAVSYQGLAT TNIRLADLAV       180
     ALGAGSMQQL LSLSPSLGSL FNAVISVASQ SGLAGVSVGG AGASNALSFG SDLNVPINIG       240
     DGGASSPGLL QVLALAGNEQ AALNATVNVL DLLTTAAQIA NSQSAVNVAP VKLNLLGLGA       300
     VTLSLKIIEP PAIAVGPPGQ FLSGPSAGQW KTQARTAQVR LGVGVLVGAP GVLAVSVPIG       360
     LQVAAAQAHA KSNSCTVPRA SSSATISAQP QPVSICIATD ADKAVNGSMD CASASPAGLV       420
     DLGPLGAVSI KANVSPIANS NWGDETIAAT QIGLNPQTDT SGKSPPRVAT QAVFSSILNS       480
     NLNQLQLTVT LPLGGTVQLG SDLAPVIAPV LALVGTTLDA VLSPLLGVLG IQLGYADIKL       540
     LSLDCDAVEL VY                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page