(data stored in ACNUC7421 zone)

EMBL: CP001069.PE477

CP001069.PE477       Location/Qualifiers
FT   CDS             547072..548487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4256"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   rso:RS02586 probable sigma-54 interacting transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4256"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29353"
FT                   /db_xref="GOA:B2UIF2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF2"
FT                   /protein_id="ACD29353.1"
FT                   /translation="MKTDRWAYETLEIFVWEGRHDIADRVARFMAPFGAEVIRAGGIDF
FT                   QPAEPRLKPAVAVISASVVESGGFTVLDWQAAQGMPVIWVASDAQHDSSRFPPEYTHVL
FT                   GPDFGATELRAQISKVLPSMSSAQAQAQDQSDLVAASPAMHGLLEQVDTFADCDSNVML
FT                   YGETGAGKERIARLLHDKNSVYGKGPFVAVNCGAIPDGLFESQFFGHAKGAFTGAMYAH
FT                   RGYFEQANGGTLFLDELGDLPLYQQVKLLRVLEDSECTRLGSTVPVKLDFRLVAATNKN
FT                   LREMVATGKFRADLYFRLAVIELRIPSLEQRGADDKIALLLSFLRHLLGDKTFDAMPPV
FT                   PEWVRASVGRAYFAGNVRELRNLAERIGITLRQFGRWDEARILPLFAGLQRDAFEREAG
FT                   NGGNGGYGDRGGGGSGGNGGEEERRRILAALDANNWRRQDTAATLGISRKVLWEKMRKY
FT                   QIADGETELRELE"
     MKTDRWAYET LEIFVWEGRH DIADRVARFM APFGAEVIRA GGIDFQPAEP RLKPAVAVIS        60
     ASVVESGGFT VLDWQAAQGM PVIWVASDAQ HDSSRFPPEY THVLGPDFGA TELRAQISKV       120
     LPSMSSAQAQ AQDQSDLVAA SPAMHGLLEQ VDTFADCDSN VMLYGETGAG KERIARLLHD       180
     KNSVYGKGPF VAVNCGAIPD GLFESQFFGH AKGAFTGAMY AHRGYFEQAN GGTLFLDELG       240
     DLPLYQQVKL LRVLEDSECT RLGSTVPVKL DFRLVAATNK NLREMVATGK FRADLYFRLA       300
     VIELRIPSLE QRGADDKIAL LLSFLRHLLG DKTFDAMPPV PEWVRASVGR AYFAGNVREL       360
     RNLAERIGIT LRQFGRWDEA RILPLFAGLQ RDAFEREAGN GGNGGYGDRG GGGSGGNGGE       420
     EERRRILAAL DANNWRRQDT AATLGISRKV LWEKMRKYQI ADGETELREL E                471
//

If you have problems or comments...

PBIL Back to PBIL home page