(data stored in SCRATCH zone)

EMBL: CP001069.PE479

CP001069.PE479       Location/Qualifiers
FT   CDS             549527..552766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4258"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; FAD-binding domain
FT                   protein; flavodoxin/nitric oxide synthase; KEGG:
FT                   rme:Rmet_3467 cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4258"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29355"
FT                   /db_xref="GOA:B2UIF4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR023206"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF4"
FT                   /protein_id="ACD29355.1"
FT                   /translation="MRSASELPANASPAAAEPIPQPKGLPWLGNLLQLPKDRLAQTLLE
FT                   TSRQFPQGLYQLDFAGRRVPFVYSADLVAELCDETRFRKLIGPPLSFLRAGAGDGLFTA
FT                   HQDEPNWGKAHRILLPAFSQRAMKGYFDVMLDVANALADKWARQGPDADIPVADDMTRL
FT                   TLDTISLAGFGYRFDSFNTPELHPFLAAMVGVLSEAMGKLTRLPLKDRFMREHHRRFEH
FT                   DVAAMHQLVDEVIRARRQAKDGGIGASDLLGLMLNARDPLSDQPLDDTNIRFQVITFLI
FT                   AGHETTSGLLTFALYMLLRHPAVLAQAYAEVDRVLPGDTVPQYAHLAQLDVIERVLKET
FT                   LRLWPTAPSFGVAPYEDTRIGGRYAIRKDQRVVTVLLALHRDPAVWDRPEAFDIDRFLP
FT                   ENEAKLHPHAYKPFGNGERACIGRQFALTEAKLALAVILQRFALSDPYDYGFHIKETLT
FT                   LKPDGFRLRARLRHARERLSVATPSRTEAVTQDDAEGALAGGGEPMHVLYGGSLGTCQD
FT                   IAEQLAATASRAGFDAKVAPLDTIADALPQRGTLVVVAATYNGRAPDSARTLEARLDAA
FT                   DALTRQATGLRYAVLGCGNSQWPAFQAFPKRVEAMLAAAGAHAIVPRGEADGNAGFDAA
FT                   VDAWTRSLWSALGARQTHADGPSVRVDYVAPDALRAAMLPPAARAMTVLANEELVSDAT
FT                   GLWDFTREAPRGPTRHLTVQLPDDVTYATGDHLAVYPRNADDRVDAAIARLALEADALV
FT                   TLTARHAHVRHLPLNQPVSVRQLLRDFVELQDTATVRDITALHAATRCPFTRGQLAVWL
FT                   EGDDAAERFDQDIQAPHVSVLDLLIRLPAIELTLEAFLARLGPMRPRFYSIASSARVSP
FT                   GVAALTVGTVSGPAWSGVGTYRGTASNYLMTLRAGAEIAAAVRTPNPPFAPDVDAHKPM
FT                   VLIGAGTGIAPFRGFLEERAAQQAAGEAVATSLLCFGCRHPEHDFLYRDTLRAWEDAGL
FT                   VRVFPAYSCVAEHPHRFVQHALWDAREAVWAAFDAGATLYVCGDGRAMAPAVRDTLIRM
FT                   HQARYGSDLATASGWLTAQMQSGRYRQDVFN"
     MRSASELPAN ASPAAAEPIP QPKGLPWLGN LLQLPKDRLA QTLLETSRQF PQGLYQLDFA        60
     GRRVPFVYSA DLVAELCDET RFRKLIGPPL SFLRAGAGDG LFTAHQDEPN WGKAHRILLP       120
     AFSQRAMKGY FDVMLDVANA LADKWARQGP DADIPVADDM TRLTLDTISL AGFGYRFDSF       180
     NTPELHPFLA AMVGVLSEAM GKLTRLPLKD RFMREHHRRF EHDVAAMHQL VDEVIRARRQ       240
     AKDGGIGASD LLGLMLNARD PLSDQPLDDT NIRFQVITFL IAGHETTSGL LTFALYMLLR       300
     HPAVLAQAYA EVDRVLPGDT VPQYAHLAQL DVIERVLKET LRLWPTAPSF GVAPYEDTRI       360
     GGRYAIRKDQ RVVTVLLALH RDPAVWDRPE AFDIDRFLPE NEAKLHPHAY KPFGNGERAC       420
     IGRQFALTEA KLALAVILQR FALSDPYDYG FHIKETLTLK PDGFRLRARL RHARERLSVA       480
     TPSRTEAVTQ DDAEGALAGG GEPMHVLYGG SLGTCQDIAE QLAATASRAG FDAKVAPLDT       540
     IADALPQRGT LVVVAATYNG RAPDSARTLE ARLDAADALT RQATGLRYAV LGCGNSQWPA       600
     FQAFPKRVEA MLAAAGAHAI VPRGEADGNA GFDAAVDAWT RSLWSALGAR QTHADGPSVR       660
     VDYVAPDALR AAMLPPAARA MTVLANEELV SDATGLWDFT REAPRGPTRH LTVQLPDDVT       720
     YATGDHLAVY PRNADDRVDA AIARLALEAD ALVTLTARHA HVRHLPLNQP VSVRQLLRDF       780
     VELQDTATVR DITALHAATR CPFTRGQLAV WLEGDDAAER FDQDIQAPHV SVLDLLIRLP       840
     AIELTLEAFL ARLGPMRPRF YSIASSARVS PGVAALTVGT VSGPAWSGVG TYRGTASNYL       900
     MTLRAGAEIA AAVRTPNPPF APDVDAHKPM VLIGAGTGIA PFRGFLEERA AQQAAGEAVA       960
     TSLLCFGCRH PEHDFLYRDT LRAWEDAGLV RVFPAYSCVA EHPHRFVQHA LWDAREAVWA      1020
     AFDAGATLYV CGDGRAMAPA VRDTLIRMHQ ARYGSDLATA SGWLTAQMQS GRYRQDVFN       1079
//

If you have problems or comments...

PBIL Back to PBIL home page