(data stored in SCRATCH zone)

EMBL: CP001069.PE48

CP001069.PE48        Location/Qualifiers
FT   CDS             54933..57359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3808"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: bte:BTH_II0144 sensor protein EvgS precursor;
FT                   PFAM: response regulator receiver; ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   Hpt domain protein; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3808"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28924"
FT                   /db_xref="GOA:B2UH73"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH73"
FT                   /protein_id="ACD28924.1"
FT                   /translation="MKGIVAAYALVASVLLCLMPGAGQAASASAFTAEERAWIAAHPVV
FT                   RTCVDAHWRPFEFVEDGKIVGIVPSFLDAVSDISGLQFEYVDGACWHGSVEALKSGRID
FT                   MSPDWSSDEDTARYRQGFIASTPYFVGTISIVTAERENLFGGSQQLAGKRVAIKGGGGL
FT                   ELAMRHNGVPVTLLTFQDESDALEAVAAGKADAALGTDASILPQLQRQFKGRLFLSGSI
FT                   WDSPYALTMVTRKDNPVLASILDKSLTAISASDADAIRHRWLETTDYGAPSLASILHYR
FT                   WRQVVAMSAVLLAFAVLAYVLWRARVAAVRSERDKAMFVAFISHEIRTPMHTILSSLEL
FT                   LQRSQLNGQQASRAVAAISASETLLALLDDVLEYSRLESRSVKLAPQPTAIGPWAQQSI
FT                   DMVRWRSDEKKLALSLDLACAPDLFIDIDSMRVRQIVLNLLVNAIKFTASGSVVLRVDY
FT                   LPAKRRGGGTLVLEVRDTGIGIPPERQRKVFEPYERVEGLGHRGASGSGLGLSICRELV
FT                   NLMRGVITVSSNPEIGTVFTVMLPVREPQADARPEGVAAAPWPQARARATKQPSPLPIE
FT                   GPLILVVDDHEAVQHAIQHQLDALGCRTAIAVTGEAALEQFRPSAFDMVLLDCDLPGID
FT                   GYTVAQRMRNMEQQQGQRTPIIAISASTDDTHRVRCFDSGMDGVLAKPLRLAALREMID
FT                   LWCAHGNAVPSATPSSEAVASAALLAIYQESMTADLKSLAHGVMTRDIAQARHAAHRIA
FT                   GAAAVVDRLRTRDLAAELERRLSAPSGEVTPDVHALLAELQSAHAADMLDHSRQP"
     MKGIVAAYAL VASVLLCLMP GAGQAASASA FTAEERAWIA AHPVVRTCVD AHWRPFEFVE        60
     DGKIVGIVPS FLDAVSDISG LQFEYVDGAC WHGSVEALKS GRIDMSPDWS SDEDTARYRQ       120
     GFIASTPYFV GTISIVTAER ENLFGGSQQL AGKRVAIKGG GGLELAMRHN GVPVTLLTFQ       180
     DESDALEAVA AGKADAALGT DASILPQLQR QFKGRLFLSG SIWDSPYALT MVTRKDNPVL       240
     ASILDKSLTA ISASDADAIR HRWLETTDYG APSLASILHY RWRQVVAMSA VLLAFAVLAY       300
     VLWRARVAAV RSERDKAMFV AFISHEIRTP MHTILSSLEL LQRSQLNGQQ ASRAVAAISA       360
     SETLLALLDD VLEYSRLESR SVKLAPQPTA IGPWAQQSID MVRWRSDEKK LALSLDLACA       420
     PDLFIDIDSM RVRQIVLNLL VNAIKFTASG SVVLRVDYLP AKRRGGGTLV LEVRDTGIGI       480
     PPERQRKVFE PYERVEGLGH RGASGSGLGL SICRELVNLM RGVITVSSNP EIGTVFTVML       540
     PVREPQADAR PEGVAAAPWP QARARATKQP SPLPIEGPLI LVVDDHEAVQ HAIQHQLDAL       600
     GCRTAIAVTG EAALEQFRPS AFDMVLLDCD LPGIDGYTVA QRMRNMEQQQ GQRTPIIAIS       660
     ASTDDTHRVR CFDSGMDGVL AKPLRLAALR EMIDLWCAHG NAVPSATPSS EAVASAALLA       720
     IYQESMTADL KSLAHGVMTR DIAQARHAAH RIAGAAAVVD RLRTRDLAAE LERRLSAPSG       780
     EVTPDVHALL AELQSAHAAD MLDHSRQP                                          808
//

If you have problems or comments...

PBIL Back to PBIL home page