(data stored in ACNUC7421 zone)

EMBL: CP001069.PE483

CP001069.PE483       Location/Qualifiers
FT   CDS             complement(554978..556117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4262"
FT                   /product="cytochrome P450-like protein"
FT                   /note="KEGG: bmu:Bmul_3696 cytochrome P450-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4262"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29359"
FT                   /db_xref="GOA:B2UIF8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF8"
FT                   /protein_id="ACD29359.1"
FT                   /translation="MTALDTAPPADVLQAIVHADPAPYYAELAATRPFFFDATLGWWVA
FT                   ASAEAVDAVLGSRACRVRPADEPVPKAVAATPTGAFFGRLVRQIDGPDHSTRKAKVMAA
FT                   LGRLDVSALAGQALRHARTALPDAASLDAALDADAHFRVPLATMAQTLLGDHADAPACQ
FT                   ADIAAYLAALGPGASAGVVAQADAAVGRLQQRFADSPFAGGDDDSDADIANLAALLAQT
FT                   YDACAGLLGNCIVALSRHAGLTARLRAQPLAIEPFVREVLRRDAPVQNTRRFVAHDIAL
FT                   LGQPLRAGDKVLVVLAAANVDGTTNPDPLRFDSDRTAPRLWTFGGGTHRCPADALATAI
FT                   ARETVRHLLSLPDVDRWLAGLGEVAYRPSPNARIPRFQA"
     MTALDTAPPA DVLQAIVHAD PAPYYAELAA TRPFFFDATL GWWVAASAEA VDAVLGSRAC        60
     RVRPADEPVP KAVAATPTGA FFGRLVRQID GPDHSTRKAK VMAALGRLDV SALAGQALRH       120
     ARTALPDAAS LDAALDADAH FRVPLATMAQ TLLGDHADAP ACQADIAAYL AALGPGASAG       180
     VVAQADAAVG RLQQRFADSP FAGGDDDSDA DIANLAALLA QTYDACAGLL GNCIVALSRH       240
     AGLTARLRAQ PLAIEPFVRE VLRRDAPVQN TRRFVAHDIA LLGQPLRAGD KVLVVLAAAN       300
     VDGTTNPDPL RFDSDRTAPR LWTFGGGTHR CPADALATAI ARETVRHLLS LPDVDRWLAG       360
     LGEVAYRPSP NARIPRFQA                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page