(data stored in ACNUC7421 zone)

EMBL: CP001069.PE484

CP001069.PE484       Location/Qualifiers
FT   CDS             556206..556922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4263"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: pol:Bpro_2808
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4263"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29360"
FT                   /db_xref="GOA:B2UIF9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF9"
FT                   /protein_id="ACD29360.1"
FT                   /translation="MTASSPATASTTQPDIGRVAATIGDPTRIRMLLLLMEGRSLTAKE
FT                   LAYGAGVEPATASAHLRRLEADALITSLSSGRYKYFGLRSPAVAEMIESLLVVAPEKPA
FT                   DPRRSVVPENLRAARLCYDHLAGQLGTEVSEKLLSRGWLTQLDATHGAYDVTPEGEQAL
FT                   AAIGVDVNALRNGRRRFAYGCMDWSERRPHLAGALGAAVAERCIALGWLARQKHSRALS
FT                   MTEAGQRELHAWLHTA"
     MTASSPATAS TTQPDIGRVA ATIGDPTRIR MLLLLMEGRS LTAKELAYGA GVEPATASAH        60
     LRRLEADALI TSLSSGRYKY FGLRSPAVAE MIESLLVVAP EKPADPRRSV VPENLRAARL       120
     CYDHLAGQLG TEVSEKLLSR GWLTQLDATH GAYDVTPEGE QALAAIGVDV NALRNGRRRF       180
     AYGCMDWSER RPHLAGALGA AVAERCIALG WLARQKHSRA LSMTEAGQRE LHAWLHTA         238
//

If you have problems or comments...

PBIL Back to PBIL home page