(data stored in ACNUC7421 zone)

EMBL: CP001069.PE486

CP001069.PE486       Location/Qualifiers
FT   CDS             complement(557537..558679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4265"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: pap:PSPA7_5127 probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4265"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29362"
FT                   /db_xref="GOA:B2UIG1"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG1"
FT                   /protein_id="ACD29362.1"
FT                   /translation="MLRPVLFRLHWLIGLSASVVLAVVGATGALMAYEDELLRALNPGV
FT                   LTLPARSGPAPTLPQVAAQARAAMPDRPVTFITAASDPTQPWRVWYAWPPGKHGGSSRG
FT                   ELRYVDATTGTLLPEARAQRFFATVKLLHRTLLADEIGKQIVGASTVGLVVMALSGLYL
FT                   RWPRRVTNWRSWLVIRWSRAGRIRWWDVHTVIGTLVLPLYLLAAFSGLYWAYDWYRDGL
FT                   QRLAGMPVVSKAKPVEVPRKPLEDAAIERTWNAFRDNASNYGTATLRIDDARSGQVDIN
FT                   WLPADAPHDRAFNRLTLDAATGAVLRNESFAAKPPMQRLLAGMLPLHNGRYFGPIGVVL
FT                   VLIGALMLPVFAATGWWLYLDRRRRAQPQRKHASAATRPC"
     MLRPVLFRLH WLIGLSASVV LAVVGATGAL MAYEDELLRA LNPGVLTLPA RSGPAPTLPQ        60
     VAAQARAAMP DRPVTFITAA SDPTQPWRVW YAWPPGKHGG SSRGELRYVD ATTGTLLPEA       120
     RAQRFFATVK LLHRTLLADE IGKQIVGAST VGLVVMALSG LYLRWPRRVT NWRSWLVIRW       180
     SRAGRIRWWD VHTVIGTLVL PLYLLAAFSG LYWAYDWYRD GLQRLAGMPV VSKAKPVEVP       240
     RKPLEDAAIE RTWNAFRDNA SNYGTATLRI DDARSGQVDI NWLPADAPHD RAFNRLTLDA       300
     ATGAVLRNES FAAKPPMQRL LAGMLPLHNG RYFGPIGVVL VLIGALMLPV FAATGWWLYL       360
     DRRRRAQPQR KHASAATRPC                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page