(data stored in ACNUC7421 zone)

EMBL: CP001069.PE488

CP001069.PE488       Location/Qualifiers
FT   CDS             561096..562172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4267"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   oxidoreductase domain protein; Oxidoreductase domain; KEGG:
FT                   rso:RS02398 probable oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4267"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29364"
FT                   /db_xref="GOA:B2UIG3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG3"
FT                   /protein_id="ACD29364.1"
FT                   /translation="MPLSAALVGYGYAGKRFHAALIDATPGLRLQVIGSNRPEAVRADR
FT                   PNAVICTPEAAATHADVDLVVIAAPNDRHAPLAEAALRAGKHVVVDKPFTVTLAEARHL
FT                   ARVARDAGRVLSVFQNRRWDSDFLAVQAAIGGGTLGEVMHVEAHFDRYRPQVRARWREQ
FT                   AGQGTGIWFDLGPHLIDQALQLLGLPDAVSASFARQRPGAETPDWAHVVLDVGERRAVL
FT                   HASMLVAGGSPRWIVHGTRGSFVKRRMDQQEAQLLAGMQPGAQGWGVDDDAGLFIDGAT
FT                   SSENRIATPAGDQRAYYAAVRDAIFGQRTNPVPPVQAVAVMAVLEAAVAAAETGTAVVP
FT                   DLTDAERADWLAARETAS"
     MPLSAALVGY GYAGKRFHAA LIDATPGLRL QVIGSNRPEA VRADRPNAVI CTPEAAATHA        60
     DVDLVVIAAP NDRHAPLAEA ALRAGKHVVV DKPFTVTLAE ARHLARVARD AGRVLSVFQN       120
     RRWDSDFLAV QAAIGGGTLG EVMHVEAHFD RYRPQVRARW REQAGQGTGI WFDLGPHLID       180
     QALQLLGLPD AVSASFARQR PGAETPDWAH VVLDVGERRA VLHASMLVAG GSPRWIVHGT       240
     RGSFVKRRMD QQEAQLLAGM QPGAQGWGVD DDAGLFIDGA TSSENRIATP AGDQRAYYAA       300
     VRDAIFGQRT NPVPPVQAVA VMAVLEAAVA AAETGTAVVP DLTDAERADW LAARETAS         358
//

If you have problems or comments...

PBIL Back to PBIL home page