(data stored in ACNUC7421 zone)

EMBL: CP001069.PE49

CP001069.PE49        Location/Qualifiers
FT   CDS             57801..58388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3809"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: pfl:PFL_3922 type I
FT                   pilus biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3809"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28925"
FT                   /db_xref="GOA:B2UH74"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH74"
FT                   /protein_id="ACD28925.1"
FT                   /translation="MKAKLFLAGVAMSTLSAAAMAQTTPTSVDGVINFQGTILSDTCKV
FT                   SSLTGDAGTINVDMGTIAADDIGTLTAPKSLANGAGSANIDVVCKTGAKVSMKFAGKTA
FT                   ELSADKKTLRVNNGNTGAGFAQGVSIAVYEGTGAGANAFDLSGGNLLAQTTVPSTGGAV
FT                   NVRFAAAYVAADPTKIKPGIANASLPFTLTYE"
     MKAKLFLAGV AMSTLSAAAM AQTTPTSVDG VINFQGTILS DTCKVSSLTG DAGTINVDMG        60
     TIAADDIGTL TAPKSLANGA GSANIDVVCK TGAKVSMKFA GKTAELSADK KTLRVNNGNT       120
     GAGFAQGVSI AVYEGTGAGA NAFDLSGGNL LAQTTVPSTG GAVNVRFAAA YVAADPTKIK       180
     PGIANASLPF TLTYE                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page