(data stored in SCRATCH zone)

EMBL: CP001069.PE490

CP001069.PE490       Location/Qualifiers
FT   CDS             complement(564308..565570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4269"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: rso:RS02397 putative
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4269"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29366"
FT                   /db_xref="GOA:B2UIG5"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG5"
FT                   /protein_id="ACD29366.1"
FT                   /translation="MPAPKLRVAATKRPTPAESSRPADAPLTTAQRIVLPAYENIALVL
FT                   QGGGALGSYQAGVFEGLDEAGIVPNWIAGISIGALNTAIIAGNAPEHRQAKLREFWQII
FT                   TQPTFSPPLPDILENAWFDGNAHLRKWLTAMQAADTLLEGQRGFFTPRFPAPLPANEVD
FT                   PLEASYYDTAPLKATLERLCDFDRINDGGIRVSVGAVNVRTGNLEAFDNTERRLRAEHF
FT                   MASGALPPGFPPVLIDGEYYWDGGVVSNTPLSYVLGSKPRRDTLVFQVDLWSALGPVPN
FT                   TMIGVASRQKDLQYSSRTRLTTDWMERSQSTRRLIRKLLDHLPPKEFERTQWYKHAQEM
FT                   ACTKRYNVFHLIYAAKEHEGPGKDIQFGPSTMRDHWASGLADIRESLSHPEWLEMPDND
FT                   TGFITHDIHRHPGVEREDKRL"
     MPAPKLRVAA TKRPTPAESS RPADAPLTTA QRIVLPAYEN IALVLQGGGA LGSYQAGVFE        60
     GLDEAGIVPN WIAGISIGAL NTAIIAGNAP EHRQAKLREF WQIITQPTFS PPLPDILENA       120
     WFDGNAHLRK WLTAMQAADT LLEGQRGFFT PRFPAPLPAN EVDPLEASYY DTAPLKATLE       180
     RLCDFDRIND GGIRVSVGAV NVRTGNLEAF DNTERRLRAE HFMASGALPP GFPPVLIDGE       240
     YYWDGGVVSN TPLSYVLGSK PRRDTLVFQV DLWSALGPVP NTMIGVASRQ KDLQYSSRTR       300
     LTTDWMERSQ STRRLIRKLL DHLPPKEFER TQWYKHAQEM ACTKRYNVFH LIYAAKEHEG       360
     PGKDIQFGPS TMRDHWASGL ADIRESLSHP EWLEMPDNDT GFITHDIHRH PGVEREDKRL       420
//

If you have problems or comments...

PBIL Back to PBIL home page