(data stored in ACNUC7421 zone)

EMBL: CP001069.PE495

CP001069.PE495       Location/Qualifiers
FT   CDS             570275..571798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4274"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase_; KEGG: rso:RS02392 probable
FT                   transmembrane aldehyde dehydrogenase oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4274"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29371"
FT                   /db_xref="GOA:B2UIH0"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH0"
FT                   /protein_id="ACD29371.1"
FT                   /translation="MNRPIDPAVTESVVSHYIGGQRHAGSGTRSADVFNPATGAVSAQV
FT                   LLGGKSEVDAAVAAAHAAAPDWAETSPLKRSRVLFKFKELLDQNHDALAAAITREHGKV
FT                   FSDAKGEVTRGIEVVEFACGIPNLLKTEFTDNIGGGIDNWNLRQPLGVVAGITPFNFPF
FT                   MVPMWMAPVALACGNTFILKPSERDPTPSLMIADLLKQAGLPDGVFNVVQGGKDAVDAL
FT                   LEHPDVQAISFVGSTPIAEYIYAEGTKRGKRVQALGGAKNHLVVMPDADLDQAVDALIG
FT                   AGYGSAGERCMAISVAVAVGDVADKLVPRLAERARALKIGNGMQADSEMGPLVTAAHKA
FT                   KVEGYIAKGVEEGAELVVDGRGHTVDGHAEGFFTGGTLFDHVKPGMTIYKEEIFGPVLS
FT                   VVRVHDLAEAVDLINAHEFGNGVSCYTSDGGVARAFARQIQVGMVGINVPIPVPMAWHS
FT                   FGGWKRSLFGDHHAYGEEGVRFYTRYKSVMQRWPDSIAKGAEFVMPTAK"
     MNRPIDPAVT ESVVSHYIGG QRHAGSGTRS ADVFNPATGA VSAQVLLGGK SEVDAAVAAA        60
     HAAAPDWAET SPLKRSRVLF KFKELLDQNH DALAAAITRE HGKVFSDAKG EVTRGIEVVE       120
     FACGIPNLLK TEFTDNIGGG IDNWNLRQPL GVVAGITPFN FPFMVPMWMA PVALACGNTF       180
     ILKPSERDPT PSLMIADLLK QAGLPDGVFN VVQGGKDAVD ALLEHPDVQA ISFVGSTPIA       240
     EYIYAEGTKR GKRVQALGGA KNHLVVMPDA DLDQAVDALI GAGYGSAGER CMAISVAVAV       300
     GDVADKLVPR LAERARALKI GNGMQADSEM GPLVTAAHKA KVEGYIAKGV EEGAELVVDG       360
     RGHTVDGHAE GFFTGGTLFD HVKPGMTIYK EEIFGPVLSV VRVHDLAEAV DLINAHEFGN       420
     GVSCYTSDGG VARAFARQIQ VGMVGINVPI PVPMAWHSFG GWKRSLFGDH HAYGEEGVRF       480
     YTRYKSVMQR WPDSIAKGAE FVMPTAK                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page