(data stored in ACNUC7421 zone)

EMBL: CP001069.PE498

CP001069.PE498       Location/Qualifiers
FT   CDS             572814..574709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4277"
FT                   /product="K potassium transporter"
FT                   /note="PFAM: K potassium transporter; KEGG: rso:RSp1052
FT                   probable potassium uptake transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4277"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29374"
FT                   /db_xref="GOA:B2UIH3"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH3"
FT                   /protein_id="ACD29374.1"
FT                   /translation="MTTAAASKTKKNPALMATMVGAIGVVFGDIGTSPLYALKECFNPE
FT                   HGVPFSDQTVFGILSMLFWAMTLVVSVKYVLFVMRADNNGEGGILALTALAMRASSGSA
FT                   RFTRTLMLLGLLGAAMFYGDAVITPAISVLSAIEGMEIMAPALQKWVLPLALIVLIALF
FT                   LIQRHGTHVVGRLFGPIMVIWFVLLGLMGLVSVVKSPQILVALSPVYAIEFGFRHTVLA
FT                   FIVFGSVFLALTGAEALYADMGHFGARPIRYAWFYIAMPCLLLNYFGQGALLLREPSAV
FT                   QNPFFLLMPNWAVGPMVVLATAATVIASQAVISGAFSMTAQAVHLGYAPRMKILYTSDV
FT                   EIGQIYVPVVNYVLLALVVAVVLAFGKSDNLAAAYGIAVTTTMVLTTGLVTVVMRNAWK
FT                   WRLSLVACIGAVFLAVDLSFFAANLLKIAAGGWFPLLLGGLIFFLMVTWHSGTQLLKAR
FT                   NVEGGIPLEPFMDGLLRHPPYRVDGTAVYLTPSIDFVPLALLHNLKHNHVLHKRVLFIH
FT                   FRTLAVPYVDPAKRLVIKTIGDDIHTAVVDFGFKETPAVDEIVRSVGERLGIVFEDMET
FT                   SFFITRATVVPSPLPGMAMWRESLFAWMQHNSAKPSDFFRIPANRLVELGSKVEI"
     MTTAAASKTK KNPALMATMV GAIGVVFGDI GTSPLYALKE CFNPEHGVPF SDQTVFGILS        60
     MLFWAMTLVV SVKYVLFVMR ADNNGEGGIL ALTALAMRAS SGSARFTRTL MLLGLLGAAM       120
     FYGDAVITPA ISVLSAIEGM EIMAPALQKW VLPLALIVLI ALFLIQRHGT HVVGRLFGPI       180
     MVIWFVLLGL MGLVSVVKSP QILVALSPVY AIEFGFRHTV LAFIVFGSVF LALTGAEALY       240
     ADMGHFGARP IRYAWFYIAM PCLLLNYFGQ GALLLREPSA VQNPFFLLMP NWAVGPMVVL       300
     ATAATVIASQ AVISGAFSMT AQAVHLGYAP RMKILYTSDV EIGQIYVPVV NYVLLALVVA       360
     VVLAFGKSDN LAAAYGIAVT TTMVLTTGLV TVVMRNAWKW RLSLVACIGA VFLAVDLSFF       420
     AANLLKIAAG GWFPLLLGGL IFFLMVTWHS GTQLLKARNV EGGIPLEPFM DGLLRHPPYR       480
     VDGTAVYLTP SIDFVPLALL HNLKHNHVLH KRVLFIHFRT LAVPYVDPAK RLVIKTIGDD       540
     IHTAVVDFGF KETPAVDEIV RSVGERLGIV FEDMETSFFI TRATVVPSPL PGMAMWRESL       600
     FAWMQHNSAK PSDFFRIPAN RLVELGSKVE I                                      631
//

If you have problems or comments...

PBIL Back to PBIL home page