(data stored in ACNUC7421 zone)

EMBL: CP001069.PE5

CP001069.PE5         Location/Qualifiers
FT   CDS             complement(3721..4026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3765"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3765"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28881"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH30"
FT                   /protein_id="ACD28881.1"
FT                   /translation="MELSETNPFPKSDGHGNLIRDDVAQAAERVKATTAQAIDRTADAA
FT                   ATALDEAAVKREQWRASQQRLMSDAAECMRTHPLATIGLAFGAGFLLSRLLGGRDD"
     MELSETNPFP KSDGHGNLIR DDVAQAAERV KATTAQAIDR TADAAATALD EAAVKREQWR        60
     ASQQRLMSDA AECMRTHPLA TIGLAFGAGF LLSRLLGGRD D                           101
//

If you have problems or comments...

PBIL Back to PBIL home page