(data stored in ACNUC7421 zone)

EMBL: CP001069.PE501

CP001069.PE501       Location/Qualifiers
FT   CDS             complement(575785..578124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4280"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
FT                   subunit; PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: rso:RS02045 putative
FT                   formate dehydrogenase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4280"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29377"
FT                   /db_xref="GOA:B2UIH6"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH6"
FT                   /protein_id="ACD29377.1"
FT                   /translation="MKHQKIEFYRHPAGGWGALKSVAHQLLSQGIAAKGAKTMLSANQP
FT                   DGFDCPGCAWPDRDHASTFEFCENGVKAVAAEATSRRTTPEFFAQHTVRELAEWSDYAL
FT                   EDQGRLTHPMVYDAGSDKYVPIDWDAAFALIAQHLRALPDPNQAIFYTSGRTSNEAAFL
FT                   YQLFVRAYGTNNFPDCSNMCHEPSGTGMRASIGVGKGTVTLDDFTKTDSIFIFGQNPGT
FT                   NHPRMLGELREASKRGAKIVSFNPLRERGLERFADPQSKIEMLTLGSTRISTEYHQVRI
FT                   GGDLATIKGIIKHVIERDDAARSRGEPAIIDHAFIAQHTGGYDAFAADVRTESWATIEA
FT                   ESGLPEHEIRQAGDTYIKAGSVIACWGMGITQHKHSVATIQMIVNLLLLRGNIGRPGAG
FT                   ACPVRGHSNVQGDRTMGIYEQPAPAFLDRLEQVFGIQVPREHGYDTVGAIEAMQQGAAR
FT                   VFFAMGGNFAAATPDTAATWAGLRQCDLTVHVTTKLNRSHIVHGKAALILPCLGRTEVD
FT                   QQAGGAQGVTVEDSMSMVHMSAGINPPASPHLLSEPAIVARLAEATLPESTIPWRWLVE
FT                   DYDRIRERIEAVFDDFAGFNEKIRVPGGFRLRNTASERVWNTPSGKAEFHAHAVPTDTP
FT                   VHRARERHADATVFTLATVRSHDQYNTTIYGMDDRYRGVFGQRRVVFINKEDLHTVRMK
FT                   DGEWVDMVTLSEDGTTRRADGFRLVAYDIPRGCLAAYYPETNPLVPLSSVADQARTPTS
FT                   KSIPVMLVPSQVARTADTQAATTAEA"
     MKHQKIEFYR HPAGGWGALK SVAHQLLSQG IAAKGAKTML SANQPDGFDC PGCAWPDRDH        60
     ASTFEFCENG VKAVAAEATS RRTTPEFFAQ HTVRELAEWS DYALEDQGRL THPMVYDAGS       120
     DKYVPIDWDA AFALIAQHLR ALPDPNQAIF YTSGRTSNEA AFLYQLFVRA YGTNNFPDCS       180
     NMCHEPSGTG MRASIGVGKG TVTLDDFTKT DSIFIFGQNP GTNHPRMLGE LREASKRGAK       240
     IVSFNPLRER GLERFADPQS KIEMLTLGST RISTEYHQVR IGGDLATIKG IIKHVIERDD       300
     AARSRGEPAI IDHAFIAQHT GGYDAFAADV RTESWATIEA ESGLPEHEIR QAGDTYIKAG       360
     SVIACWGMGI TQHKHSVATI QMIVNLLLLR GNIGRPGAGA CPVRGHSNVQ GDRTMGIYEQ       420
     PAPAFLDRLE QVFGIQVPRE HGYDTVGAIE AMQQGAARVF FAMGGNFAAA TPDTAATWAG       480
     LRQCDLTVHV TTKLNRSHIV HGKAALILPC LGRTEVDQQA GGAQGVTVED SMSMVHMSAG       540
     INPPASPHLL SEPAIVARLA EATLPESTIP WRWLVEDYDR IRERIEAVFD DFAGFNEKIR       600
     VPGGFRLRNT ASERVWNTPS GKAEFHAHAV PTDTPVHRAR ERHADATVFT LATVRSHDQY       660
     NTTIYGMDDR YRGVFGQRRV VFINKEDLHT VRMKDGEWVD MVTLSEDGTT RRADGFRLVA       720
     YDIPRGCLAA YYPETNPLVP LSSVADQART PTSKSIPVML VPSQVARTAD TQAATTAEA        779
//

If you have problems or comments...

PBIL Back to PBIL home page