(data stored in ACNUC7421 zone)

EMBL: CP001069.PE502

CP001069.PE502       Location/Qualifiers
FT   CDS             complement(578153..579880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4281"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS02384 probable transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4281"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29378"
FT                   /db_xref="GOA:B2UIH7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH7"
FT                   /protein_id="ACD29378.1"
FT                   /translation="MTGAAAPFHHVRHNTGSTYPGVDSMSEAVLHPFFSRERTVAAVGF
FT                   NRWLVPPAALAIHLCIGMAYGFSVFWLPLGRALGITKPLTCGADVSLVAELFTTTCDWR
FT                   VSSLGWMFTLFFVFLGASAAMWGGWLERVGPRKAGVVSAVCWCGGLLISALGIQIHQLW
FT                   LLWVGSGVIGGVGLGLGYISPVSTLIKWFPDKRGMATGMAIMGFGGGAMIGAPLADRLM
FT                   KLFATPESVGVSQTFIVLAGIYFVFMMAGALGYRVPPTGWKPAGWTPSPAKAKDTMVTQ
FT                   RHVHANEALKTPQFWLIWAVLCLNVSAGIGVLGMASPLLQEVFGGKLLGVTTSFMDLTA
FT                   AQKGQIAAIAAGFTGLLSLFNIGGRFFWASLSDRLGRKMTYAVFFVLGFVLYASIPWTS
FT                   HTGNIALFALAFCVILSMYGGGFATVPAYLADMFGTQMVGAIHGRLLTAWSTAGILGPV
FT                   LVNYLREYQIAHGVERAAVYDITMMILAGLLILGFICNLLVRPVNAKHFMTEAQLDEQR
FT                   HAAATKSPTPSVASPETSLEWQAHPGSAVAVVLAWAAVGLPLGWGVWITLQKAAVLFS"
     MTGAAAPFHH VRHNTGSTYP GVDSMSEAVL HPFFSRERTV AAVGFNRWLV PPAALAIHLC        60
     IGMAYGFSVF WLPLGRALGI TKPLTCGADV SLVAELFTTT CDWRVSSLGW MFTLFFVFLG       120
     ASAAMWGGWL ERVGPRKAGV VSAVCWCGGL LISALGIQIH QLWLLWVGSG VIGGVGLGLG       180
     YISPVSTLIK WFPDKRGMAT GMAIMGFGGG AMIGAPLADR LMKLFATPES VGVSQTFIVL       240
     AGIYFVFMMA GALGYRVPPT GWKPAGWTPS PAKAKDTMVT QRHVHANEAL KTPQFWLIWA       300
     VLCLNVSAGI GVLGMASPLL QEVFGGKLLG VTTSFMDLTA AQKGQIAAIA AGFTGLLSLF       360
     NIGGRFFWAS LSDRLGRKMT YAVFFVLGFV LYASIPWTSH TGNIALFALA FCVILSMYGG       420
     GFATVPAYLA DMFGTQMVGA IHGRLLTAWS TAGILGPVLV NYLREYQIAH GVERAAVYDI       480
     TMMILAGLLI LGFICNLLVR PVNAKHFMTE AQLDEQRHAA ATKSPTPSVA SPETSLEWQA       540
     HPGSAVAVVL AWAAVGLPLG WGVWITLQKA AVLFS                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page