(data stored in ACNUC7421 zone)

EMBL: CP001069.PE504

CP001069.PE504       Location/Qualifiers
FT   CDS             complement(580661..583756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4283"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: pnu:Pnuc_1300 heavy
FT                   metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4283"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29380"
FT                   /db_xref="GOA:B2UIH9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH9"
FT                   /protein_id="ACD29380.1"
FT                   /translation="MGFNPIAGILKRRLLIVFLAVALLVAGVLSFRELPLQAYPGVAPL
FT                   SVQAITQWPGRSTTEVEQQITIPIENALAGVPDVQSFRSVSLFGLSVVTLKFKEGTDSF
FT                   KARQNFSQYLASANLPTGVQSSLSPDSDATGEIMRFRLEGDGVDLTTLKSYQDYDISKG
FT                   LKHVQGVADVSSFGGKVKEYHIVPSPAKLQSYGITLSQLITAIGNANNNTGGNLLRDGE
FT                   QQFVVRGVGLLQTVDDIRNVVVNTNNGVPVRVRDIAEVEVGNVQRLGQVQYNDQPDVVE
FT                   GIVLLKRDANATEVLAKVREKVAELNNGVLPKSIQVKPFYDRQVLLDITMGTVEHTLVV
FT                   GISLVLAVLFVFLGNFRAAAVVAAVIPLALCVSFISMEHFHVPANLISLGAIDFGVIVD
FT                   AAVIVMENIMRHLEEGAEKLEDAIIKATNEVQRAMIFSTGIIIVAYSPLFFIGGVEGII
FT                   FKPMAFTMGFALMASIVLSLTFVPATTSFVFGKTLHPHSPAFIAAILRWYKPLLRKLIA
FT                   RPMAVFATAITALLLTLYSATFLGTEFLPTLEENNLWLRITLPNTVDLDYSASVANDLR
FT                   IYFTKQPEIKQVSVQIGRPDDGTDSTGVFNQEYGLYFAPPDQWEAGMTKGKLVERLSKH
FT                   LEKIPGIEYNFSQYIQDNVDEALSGVKGENSVKLFGNDLNMLEAKANEIQAQLKKVSGL
FT                   VDVGIFRELGQPTLNVSIDRQAAARFNINVSDVQNLVQYAIGGAPVTQILEGEKSFGLA
FT                   VRLNQQARASYDAIRELLIDTPDGQHIPLSMIAKVEMTDGPFFIYREEGKRYIAIKFGV
FT                   RGRDLGGAVDEAQHVVGSNVKLPEGYTVKWDGQFNEMKVAQGKLMVIVPLTILVIFLLL
FT                   YSTFGNFKDALMVVLNVPFAAIGGLLALHIANETLSISAGIGFLSLFGIAIQDGVILIS
FT                   YVNRLSQSENVREATVDGAALRLRPVIMTAMLAGLGLLPAALSHSIGSEAQRPLALVIV
FT                   GGMVTTTILTLLVLPVVFTWAHRHRRPPPRDSDVNPTAAMLP"
     MGFNPIAGIL KRRLLIVFLA VALLVAGVLS FRELPLQAYP GVAPLSVQAI TQWPGRSTTE        60
     VEQQITIPIE NALAGVPDVQ SFRSVSLFGL SVVTLKFKEG TDSFKARQNF SQYLASANLP       120
     TGVQSSLSPD SDATGEIMRF RLEGDGVDLT TLKSYQDYDI SKGLKHVQGV ADVSSFGGKV       180
     KEYHIVPSPA KLQSYGITLS QLITAIGNAN NNTGGNLLRD GEQQFVVRGV GLLQTVDDIR       240
     NVVVNTNNGV PVRVRDIAEV EVGNVQRLGQ VQYNDQPDVV EGIVLLKRDA NATEVLAKVR       300
     EKVAELNNGV LPKSIQVKPF YDRQVLLDIT MGTVEHTLVV GISLVLAVLF VFLGNFRAAA       360
     VVAAVIPLAL CVSFISMEHF HVPANLISLG AIDFGVIVDA AVIVMENIMR HLEEGAEKLE       420
     DAIIKATNEV QRAMIFSTGI IIVAYSPLFF IGGVEGIIFK PMAFTMGFAL MASIVLSLTF       480
     VPATTSFVFG KTLHPHSPAF IAAILRWYKP LLRKLIARPM AVFATAITAL LLTLYSATFL       540
     GTEFLPTLEE NNLWLRITLP NTVDLDYSAS VANDLRIYFT KQPEIKQVSV QIGRPDDGTD       600
     STGVFNQEYG LYFAPPDQWE AGMTKGKLVE RLSKHLEKIP GIEYNFSQYI QDNVDEALSG       660
     VKGENSVKLF GNDLNMLEAK ANEIQAQLKK VSGLVDVGIF RELGQPTLNV SIDRQAAARF       720
     NINVSDVQNL VQYAIGGAPV TQILEGEKSF GLAVRLNQQA RASYDAIREL LIDTPDGQHI       780
     PLSMIAKVEM TDGPFFIYRE EGKRYIAIKF GVRGRDLGGA VDEAQHVVGS NVKLPEGYTV       840
     KWDGQFNEMK VAQGKLMVIV PLTILVIFLL LYSTFGNFKD ALMVVLNVPF AAIGGLLALH       900
     IANETLSISA GIGFLSLFGI AIQDGVILIS YVNRLSQSEN VREATVDGAA LRLRPVIMTA       960
     MLAGLGLLPA ALSHSIGSEA QRPLALVIVG GMVTTTILTL LVLPVVFTWA HRHRRPPPRD      1020
     SDVNPTAAML P                                                           1031
//

If you have problems or comments...

PBIL Back to PBIL home page