(data stored in ACNUC7421 zone)

EMBL: CP001069.PE507

CP001069.PE507       Location/Qualifiers
FT   CDS             complement(586440..586841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4286"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: pfo:Pfl_0677 possible
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4286"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29383"
FT                   /db_xref="GOA:B2UII2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII2"
FT                   /protein_id="ACD29383.1"
FT                   /translation="MPAALPAPISNAHTGDLSIGDLAAATGVSRDGLRFYEARGLIRAR
FT                   RRSNGYRAYPPEIVELVQYVRTAQQLGFTLAEIREGMAQVWQQPDTVAAVTALLREKLA
FT                   TIDARIASLQAMREALATRVGMACPLAPA"
     MPAALPAPIS NAHTGDLSIG DLAAATGVSR DGLRFYEARG LIRARRRSNG YRAYPPEIVE        60
     LVQYVRTAQQ LGFTLAEIRE GMAQVWQQPD TVAAVTALLR EKLATIDARI ASLQAMREAL       120
     ATRVGMACPL APA                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page