(data stored in SCRATCH zone)

EMBL: CP001069.PE508

CP001069.PE508       Location/Qualifiers
FT   CDS             586943..587365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_0678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4287"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29384"
FT                   /db_xref="GOA:B2UII3"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII3"
FT                   /protein_id="ACD29384.1"
FT                   /translation="MVSESTFLRIVRASAWYDLIVTAPFATPWTFALLHQALSALAHAL
FT                   GIGSLPPFEPTHLLMANLMGSVVCVWSVLRIRQTSVVLGRYDAVARGLFAAWQAYALAS
FT                   GATLLVVPFLIAEIGFGLLQSLPVGRVPGRAGARAA"
     MVSESTFLRI VRASAWYDLI VTAPFATPWT FALLHQALSA LAHALGIGSL PPFEPTHLLM        60
     ANLMGSVVCV WSVLRIRQTS VVLGRYDAVA RGLFAAWQAY ALASGATLLV VPFLIAEIGF       120
     GLLQSLPVGR VPGRAGARAA                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page