(data stored in ACNUC7421 zone)

EMBL: CP001069.PE512

CP001069.PE512       Location/Qualifiers
FT   CDS             complement(589069..589935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4291"
FT                   /product="protein of unknown function DUF692"
FT                   /note="PFAM: protein of unknown function DUF692; KEGG:
FT                   rso:RS02372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4291"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29388"
FT                   /db_xref="InterPro:IPR007801"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII7"
FT                   /protein_id="ACD29388.1"
FT                   /translation="MQTALPTCAGAGLRAPHFPALLHGEARFPWAEVHSENYLYGGPAR
FT                   AALLAARAHQPVSLHGVGMGLGNADGLDVEHVRAIAMLADAVAPAAISEHLCFNRSGAQ
FT                   VVNDLLPLPYSRESLDIVCANVMRAQDILKQPLLIENIAAYIDCRTLVDADEAISEGAF
FT                   LTALARRTGCGILLDLNNLYVNSVNHGVTVESVLTDIDPALVGEIHLAGFSVEDGMLID
FT                   THSAPVHAPVWALYNAWVAKHGARPTLIEWDAELPPVQVLLDEAARAQAVLNRHTNAMQ
FT                   ETRHATA"
     MQTALPTCAG AGLRAPHFPA LLHGEARFPW AEVHSENYLY GGPARAALLA ARAHQPVSLH        60
     GVGMGLGNAD GLDVEHVRAI AMLADAVAPA AISEHLCFNR SGAQVVNDLL PLPYSRESLD       120
     IVCANVMRAQ DILKQPLLIE NIAAYIDCRT LVDADEAISE GAFLTALARR TGCGILLDLN       180
     NLYVNSVNHG VTVESVLTDI DPALVGEIHL AGFSVEDGML IDTHSAPVHA PVWALYNAWV       240
     AKHGARPTLI EWDAELPPVQ VLLDEAARAQ AVLNRHTNAM QETRHATA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page