(data stored in ACNUC7421 zone)

EMBL: CP001069.PE513

CP001069.PE513       Location/Qualifiers
FT   CDS             complement(589957..590223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4292"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS02371 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4292"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29389"
FT                   /db_xref="InterPro:IPR018740"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII8"
FT                   /protein_id="ACD29389.1"
FT                   /translation="MKQHAMIAAALGSLLALGALSTPVHAADAAGKEKCYGVAKAGQND
FT                   CASPGSAHACAGQSKIDKDPMSWKYVPAGTCAQMGGTMQTPSK"
     MKQHAMIAAA LGSLLALGAL STPVHAADAA GKEKCYGVAK AGQNDCASPG SAHACAGQSK        60
     IDKDPMSWKY VPAGTCAQMG GTMQTPSK                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page