(data stored in ACNUC7421 zone)

EMBL: CP001069.PE516

CP001069.PE516       Location/Qualifiers
FT   CDS             complement(591525..592466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4295"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: mlo:mlr3911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4295"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29392"
FT                   /db_xref="GOA:B2UIJ1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ1"
FT                   /protein_id="ACD29392.1"
FT                   /translation="MRSFLHPMLKVVRMNDKTRGTVEMTTAMVISGTIGWFVVRSGQPV
FT                   ADVVFWRCVFGALTLLAVCAGLGLLRGAITWRRAAIATLGGVAIVINWLLLFAAYPRAS
FT                   ISIATAVYNTQPFMLVGLGAMFLSEKLTAAKLTWLAIAFIGVVLIVQVGPAASVGTDYL
FT                   AGIAMALGAAFAYAVAALLIKKLAGTPPHLIALIQVCVGVLMLAPLANLSHPPADAHTW
FT                   VMLVTVGVVHTGLMYILLYGAIQRLPTHLTGSLSFVYPIVAIVVDIVAFGHRLQLAQFL
FT                   GAGGILLAAAGMNLGWSPYRWLRARAESPVSK"
     MRSFLHPMLK VVRMNDKTRG TVEMTTAMVI SGTIGWFVVR SGQPVADVVF WRCVFGALTL        60
     LAVCAGLGLL RGAITWRRAA IATLGGVAIV INWLLLFAAY PRASISIATA VYNTQPFMLV       120
     GLGAMFLSEK LTAAKLTWLA IAFIGVVLIV QVGPAASVGT DYLAGIAMAL GAAFAYAVAA       180
     LLIKKLAGTP PHLIALIQVC VGVLMLAPLA NLSHPPADAH TWVMLVTVGV VHTGLMYILL       240
     YGAIQRLPTH LTGSLSFVYP IVAIVVDIVA FGHRLQLAQF LGAGGILLAA AGMNLGWSPY       300
     RWLRARAESP VSK                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page