(data stored in ACNUC7421 zone)

EMBL: CP001069.PE517

CP001069.PE517       Location/Qualifiers
FT   CDS             592562..593014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4296"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   mlo:mll3910 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4296"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29393"
FT                   /db_xref="GOA:B2UIJ2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ2"
FT                   /protein_id="ACD29393.1"
FT                   /translation="MNTIDALDQRILDVLLTDSRISLKQLAEQVGLSSPSVSERLRRLE
FT                   ERGVIRHYTIDIDPASLGYTLQAIVRVRPMPGKLHIVQKLIEEIPEIGECDKVTGEDCF
FT                   IARLYVRSIDQLDQILDRVAYHAETNTAIVKTQPVKRRAPPFASAE"
     MNTIDALDQR ILDVLLTDSR ISLKQLAEQV GLSSPSVSER LRRLEERGVI RHYTIDIDPA        60
     SLGYTLQAIV RVRPMPGKLH IVQKLIEEIP EIGECDKVTG EDCFIARLYV RSIDQLDQIL       120
     DRVAYHAETN TAIVKTQPVK RRAPPFASAE                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page