(data stored in SCRATCH zone)

EMBL: CP001069.PE519

CP001069.PE519       Location/Qualifiers
FT   CDS             594934..596664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4299"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: rso:RSp0274 probable
FT                   gamma-glutamyltranspeptidase signal peptide protein;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4299"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29395"
FT                   /db_xref="GOA:B2UIJ4"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ4"
FT                   /protein_id="ACD29395.1"
FT                   /translation="MQNPRTGMRWIAAAIASISITTVTHAASVAPVAAENGMVVAAQHL
FT                   ASKVGVEVLKRGGNAVDAAVAVGYALAVVYPAAGNLGGGGFMTIQLADGRKTFLDFREV
FT                   APKAATANMYLDKDGNVIKGASTKGHLAVGVPGTVSGMEYARQKYGTMQRAALIAPAIT
FT                   LAEKGFVLDQGDVDMLHTSTKDFQEDAASGAIFLNKGQPFQVGEKLVQHDLAKTLREIS
FT                   THGTDGFYKGWVGQAIAASSKAGGGLITQDDLVSYKTRELAPVECDYRGYHVVSAPPPS
FT                   SGGVIICEMLNILEGYPLKDLGWHSAQATHYQIEAMRHAYVDRNSYLGDPDFVKNPLDR
FT                   LLSKDYAAKIRAVIDPKKAGVSKDIKPGVEPHEGSNTTHYSIADKYGNAVSVTYTLNDW
FT                   FGAKVTAAKTGVILNDEMDDFTAKVGVPNLYGLVQGEANSIAPGKRPLSSMSPTIVTKD
FT                   GKPVMVVGTPGGSRIITAVMLTMINAIDYGMNVQEAVDMPRFHQQWLPDVTNVEPYALS
FT                   EDTRKILTSMGHNLGAPQPANHLAAIIVGAPSLGGKPVGNNRFYGANDPRRNTGLAAGY
FT                   "
     MQNPRTGMRW IAAAIASISI TTVTHAASVA PVAAENGMVV AAQHLASKVG VEVLKRGGNA        60
     VDAAVAVGYA LAVVYPAAGN LGGGGFMTIQ LADGRKTFLD FREVAPKAAT ANMYLDKDGN       120
     VIKGASTKGH LAVGVPGTVS GMEYARQKYG TMQRAALIAP AITLAEKGFV LDQGDVDMLH       180
     TSTKDFQEDA ASGAIFLNKG QPFQVGEKLV QHDLAKTLRE ISTHGTDGFY KGWVGQAIAA       240
     SSKAGGGLIT QDDLVSYKTR ELAPVECDYR GYHVVSAPPP SSGGVIICEM LNILEGYPLK       300
     DLGWHSAQAT HYQIEAMRHA YVDRNSYLGD PDFVKNPLDR LLSKDYAAKI RAVIDPKKAG       360
     VSKDIKPGVE PHEGSNTTHY SIADKYGNAV SVTYTLNDWF GAKVTAAKTG VILNDEMDDF       420
     TAKVGVPNLY GLVQGEANSI APGKRPLSSM SPTIVTKDGK PVMVVGTPGG SRIITAVMLT       480
     MINAIDYGMN VQEAVDMPRF HQQWLPDVTN VEPYALSEDT RKILTSMGHN LGAPQPANHL       540
     AAIIVGAPSL GGKPVGNNRF YGANDPRRNT GLAAGY                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page