(data stored in ACNUC7421 zone)

EMBL: CP001069.PE52

CP001069.PE52        Location/Qualifiers
FT   CDS             63686..63982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3814"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   rme:Rmet_6073 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3814"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28928"
FT                   /db_xref="GOA:B2UH77"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH77"
FT                   /protein_id="ACD28928.1"
FT                   /translation="MTSKTKRAQYTLEFKLEAVRLVKSGQSMAVVSATLGIRAQTLHNW
FT                   VKAEREGKLTGAGMKPVSPEQMELARLRAEVARLKMERDILKKAAAYFAKESV"
     MTSKTKRAQY TLEFKLEAVR LVKSGQSMAV VSATLGIRAQ TLHNWVKAER EGKLTGAGMK        60
     PVSPEQMELA RLRAEVARLK MERDILKKAA AYFAKESV                                98
//

If you have problems or comments...

PBIL Back to PBIL home page