(data stored in ACNUC7421 zone)

EMBL: CP001069.PE522

CP001069.PE522       Location/Qualifiers
FT   CDS             complement(599091..599924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4302"
FT                   /product="Shikimate dehydrogenase substrate binding domain
FT                   protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: dac:Daci_4437
FT                   shikimate dehydrogenase substrate binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4302"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29398"
FT                   /db_xref="GOA:B2UIJ7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ7"
FT                   /protein_id="ACD29398.1"
FT                   /translation="MISGKTTLIAHIGYPTETFKSPMIYNPWFEQKGIDAVVMPMGVKA
FT                   EDYPQSFASICRFTNLRGALITMPHKVTTVELVDEVTPAVRIAGACNAVLKRDDGTLLG
FT                   DQFDGAGFVRGVLRKGRQLEGARVLLSGAGGVGSAIAASLAAAGVGELALYDTRAESAE
FT                   SLGRRLLEHYPALAVGTGSNDPDGFDVVVNATPVGMKDDDPLPFDAARIAPSCFVGEVV
FT                   MKSEYTPLLRAALDKGCDVQVGTDMLFEMIPAYLEFFGFGTATADELRRSAAIAY"
     MISGKTTLIA HIGYPTETFK SPMIYNPWFE QKGIDAVVMP MGVKAEDYPQ SFASICRFTN        60
     LRGALITMPH KVTTVELVDE VTPAVRIAGA CNAVLKRDDG TLLGDQFDGA GFVRGVLRKG       120
     RQLEGARVLL SGAGGVGSAI AASLAAAGVG ELALYDTRAE SAESLGRRLL EHYPALAVGT       180
     GSNDPDGFDV VVNATPVGMK DDDPLPFDAA RIAPSCFVGE VVMKSEYTPL LRAALDKGCD       240
     VQVGTDMLFE MIPAYLEFFG FGTATADELR RSAAIAY                                277
//

If you have problems or comments...

PBIL Back to PBIL home page