(data stored in ACNUC7421 zone)

EMBL: CP001069.PE523

CP001069.PE523       Location/Qualifiers
FT   CDS             complement(599944..601329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4303"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: dac:Daci_4438 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4303"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29399"
FT                   /db_xref="GOA:B2UIJ8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ8"
FT                   /protein_id="ACD29399.1"
FT                   /translation="MTAAPAHEPLGKHQSKKAAASGWIGSALEYYDFFIYATAAALIFP
FT                   QIFFPKGDPKTAIIASLATYGVGYIARPIGAFVLGHLGDTHGRKNVLLWCMFLMGFSTI
FT                   AVGLLPTYDQVGLWAPTLLVIMRLIQGFAVAGEISGASSMILEHAPFGRRGFFASFTLQ
FT                   GVQAGQILAAAVFLPLAHYMPADQFNSWGWRIPFLLSFVVIIAGYVIRREVHETPAFTA
FT                   EQQQQGRPRSPVIDAFKYSTPDMLRVVCMALMNVIPVVATIFGAAYAVQPAYGIGFAKD
FT                   IYLWIPVVGNIVAVLVIPYVGDLSDRIGRKPPIVLGSLLAGVLAFAYLYAISIKNVPLA
FT                   FGMSILMWGVVYQGYNAVFPSFYPELFPTRTRVSAMAISQNIGTAITAMLPALFTAVAP
FT                   PGATNIWLTVGAIAFGVTVIAAVAAMTARETYRIHMDDLGQPAAQPVDKAEYARQRAGA
FT                   LAA"
     MTAAPAHEPL GKHQSKKAAA SGWIGSALEY YDFFIYATAA ALIFPQIFFP KGDPKTAIIA        60
     SLATYGVGYI ARPIGAFVLG HLGDTHGRKN VLLWCMFLMG FSTIAVGLLP TYDQVGLWAP       120
     TLLVIMRLIQ GFAVAGEISG ASSMILEHAP FGRRGFFASF TLQGVQAGQI LAAAVFLPLA       180
     HYMPADQFNS WGWRIPFLLS FVVIIAGYVI RREVHETPAF TAEQQQQGRP RSPVIDAFKY       240
     STPDMLRVVC MALMNVIPVV ATIFGAAYAV QPAYGIGFAK DIYLWIPVVG NIVAVLVIPY       300
     VGDLSDRIGR KPPIVLGSLL AGVLAFAYLY AISIKNVPLA FGMSILMWGV VYQGYNAVFP       360
     SFYPELFPTR TRVSAMAISQ NIGTAITAML PALFTAVAPP GATNIWLTVG AIAFGVTVIA       420
     AVAAMTARET YRIHMDDLGQ PAAQPVDKAE YARQRAGALA A                           461
//

If you have problems or comments...

PBIL Back to PBIL home page