(data stored in ACNUC7421 zone)

EMBL: CP001069.PE524

CP001069.PE524       Location/Qualifiers
FT   CDS             complement(601561..602328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4304"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: reu:Reut_B5034 regulatory protein,
FT                   IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4304"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29400"
FT                   /db_xref="GOA:B2UIJ9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ9"
FT                   /protein_id="ACD29400.1"
FT                   /translation="MTKEPLNRRDWIAGLEKGLAILEAFDHEHPRLTPTQAAELTGLTR
FT                   TAARRYLLTLEHLGYLTSEGTLFSLTPRVLKVGWSYFDSARLPRTVQPFLQQVTAAVGE
FT                   VAYLSVLDDWELVFISRTSTSRVMSTGFVLGARVPAPLASAGVMMLAAQPEQKVKAWLE
FT                   TCVLTPYTPYTILQRDRLFDEIRKAGRQDYAVVEQQLQIGVRGVAVPLRDRHGNVIAAL
FT                   SVNMQVGEETTEHALQRVLQVLQDTALSIMRVL"
     MTKEPLNRRD WIAGLEKGLA ILEAFDHEHP RLTPTQAAEL TGLTRTAARR YLLTLEHLGY        60
     LTSEGTLFSL TPRVLKVGWS YFDSARLPRT VQPFLQQVTA AVGEVAYLSV LDDWELVFIS       120
     RTSTSRVMST GFVLGARVPA PLASAGVMML AAQPEQKVKA WLETCVLTPY TPYTILQRDR       180
     LFDEIRKAGR QDYAVVEQQL QIGVRGVAVP LRDRHGNVIA ALSVNMQVGE ETTEHALQRV       240
     LQVLQDTALS IMRVL                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page