(data stored in ACNUC7421 zone)

EMBL: CP001069.PE525

CP001069.PE525       Location/Qualifiers
FT   CDS             602459..604345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4305"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: reu:Reut_B5035 4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4305"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29401"
FT                   /db_xref="GOA:B2UIK0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK0"
FT                   /protein_id="ACD29401.1"
FT                   /translation="MNSLRAARYPKCIATVCLSGTLPEKLEAAAAAGFDGIEIFENDLL
FT                   NFDGSPDRVRQMAADLGLAIMLYQPFRDFEAMPRELFARNLARAERKFDVMAELGVETV
FT                   LVCSNVQDIAIDDPARAADDLRQMAEAAAGRGLRVGYEALAWGRHTRTWRQAWQIVQQA
FT                   DHPALGLILDSFHTLSLGDTLDGLHNVPADKLFFVQFADAPRLSMDVLSWSRHHRNFPG
FT                   QGDLPVTDFARDLLAAGYTGPLSLEVFNDDFRSAPARLTALDGMRSLLWLESEAGGAEL
FT                   PAAAQFEGVDFLEFAVDAAAGRELETRLRALGFAFAGHHRSKAVDLYRQGRVNVILNME
FT                   QDSAASEHFELHGPSVCAIGLKVDDAERAMARARVLCAQEWRGPVGPAERSIPALRAPD
FT                   GTLLYLIDDRQADRSIYESDFVLHPGMQDDAAGLASIDHVAHALPAHRLDSFVLFYRAI
FT                   FGMEAEPEQEIADPYGLVKSRAMVSPDRNVRIPLNVSESGRTATGRFIAAYAGSGVHHI
FT                   AFRTERLFETIEAIDRGAAHLQHVPENYYDDVAARLGLDDALLTRLHDDGLLYDRDPHG
FT                   DFLHTYTEPFRERFFFELVQRNGYLGYGAANAAVRMAVQAQLSRTTTNTADH"
     MNSLRAARYP KCIATVCLSG TLPEKLEAAA AAGFDGIEIF ENDLLNFDGS PDRVRQMAAD        60
     LGLAIMLYQP FRDFEAMPRE LFARNLARAE RKFDVMAELG VETVLVCSNV QDIAIDDPAR       120
     AADDLRQMAE AAAGRGLRVG YEALAWGRHT RTWRQAWQIV QQADHPALGL ILDSFHTLSL       180
     GDTLDGLHNV PADKLFFVQF ADAPRLSMDV LSWSRHHRNF PGQGDLPVTD FARDLLAAGY       240
     TGPLSLEVFN DDFRSAPARL TALDGMRSLL WLESEAGGAE LPAAAQFEGV DFLEFAVDAA       300
     AGRELETRLR ALGFAFAGHH RSKAVDLYRQ GRVNVILNME QDSAASEHFE LHGPSVCAIG       360
     LKVDDAERAM ARARVLCAQE WRGPVGPAER SIPALRAPDG TLLYLIDDRQ ADRSIYESDF       420
     VLHPGMQDDA AGLASIDHVA HALPAHRLDS FVLFYRAIFG MEAEPEQEIA DPYGLVKSRA       480
     MVSPDRNVRI PLNVSESGRT ATGRFIAAYA GSGVHHIAFR TERLFETIEA IDRGAAHLQH       540
     VPENYYDDVA ARLGLDDALL TRLHDDGLLY DRDPHGDFLH TYTEPFRERF FFELVQRNGY       600
     LGYGAANAAV RMAVQAQLSR TTTNTADH                                          628
//

If you have problems or comments...

PBIL Back to PBIL home page