(data stored in ACNUC7421 zone)

EMBL: CP001069.PE527

CP001069.PE527       Location/Qualifiers
FT   CDS             complement(605599..606852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4307"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   reu:Reut_B3726 D-amino acid dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4307"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29403"
FT                   /db_xref="GOA:B2UIK2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK2"
FT                   /protein_id="ACD29403.1"
FT                   /translation="MTHIVIVGAGISGVTTAYTLSQLGYQVTVLDRHLYPAMETSFANG
FT                   GQLSASNAEVWNSTGTLLKGIKWMLRNDAPLLLNPKPSWHKYSWIGEFVASIAHYRRNT
FT                   IETTRMAIEARKHLFAMAEREQIDFDLQKRGILHVYHDKASFAAAGKANALLVAGGLER
FT                   HAVSPEEIAAIEPTLRGNYYGGYFTESDATGDIHKFTRGLAQACERRGVRFMQGVDVRD
FT                   VQTTEGGVSLLLQTTLDDRLSTSAANIVQDLAADAMVVCAGVGSRHIAQLVGDRINVYP
FT                   VKGYSITVHLDDEASVQGAPWVSLLDESAKIVTSRLGTGRFRVAGTAEFNGYNRDIRAD
FT                   RIEPLVAWTRRNFAIGTSRVVPWAGLRPMMPDMMPRVGRGRHARVFYNTGHGHLGWTLS
FT                   GATAAMVGDVIARDCPVH"
     MTHIVIVGAG ISGVTTAYTL SQLGYQVTVL DRHLYPAMET SFANGGQLSA SNAEVWNSTG        60
     TLLKGIKWML RNDAPLLLNP KPSWHKYSWI GEFVASIAHY RRNTIETTRM AIEARKHLFA       120
     MAEREQIDFD LQKRGILHVY HDKASFAAAG KANALLVAGG LERHAVSPEE IAAIEPTLRG       180
     NYYGGYFTES DATGDIHKFT RGLAQACERR GVRFMQGVDV RDVQTTEGGV SLLLQTTLDD       240
     RLSTSAANIV QDLAADAMVV CAGVGSRHIA QLVGDRINVY PVKGYSITVH LDDEASVQGA       300
     PWVSLLDESA KIVTSRLGTG RFRVAGTAEF NGYNRDIRAD RIEPLVAWTR RNFAIGTSRV       360
     VPWAGLRPMM PDMMPRVGRG RHARVFYNTG HGHLGWTLSG ATAAMVGDVI ARDCPVH          417
//

If you have problems or comments...

PBIL Back to PBIL home page