(data stored in ACNUC7421 zone)

EMBL: CP001069.PE529

CP001069.PE529       Location/Qualifiers
FT   CDS             complement(607980..609362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4309"
FT                   /product="Ethanolamine ammonia lyase large subunit"
FT                   /note="PFAM: Ethanolamine ammonia lyase large subunit;
FT                   KEGG: reh:H16_B0096 ethanolamine ammonia-lyase heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4309"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29405"
FT                   /db_xref="GOA:B2UIK4"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK4"
FT                   /protein_id="ACD29405.1"
FT                   /translation="MHFDHTIGAQRHVFNDLKTLLAKASPSRSGDYLAGLAAASEGERM
FT                   AARMALADVPLSVFLNEALVPYEDDEVTRLILDRHDAQAFQPIASLTVGEFRNWLLLHE
FT                   TDSQTLASVATGVTPEMAAAVSKLMRNQDLVAVARKCRVVTRFRNTIGLPGRLSVRLQP
FT                   NHPTDDPKGIAASIIDGLLYGCGDATIGINPAGDNLGAIVSLLQLVDELRNRYAIPTQS
FT                   CVLTHVTNTVRAIDQGAPVDLMFQSVAGSEQANARFGISLALLAEAHDAAQSLARGTVG
FT                   NNVMYFETGQGSALSANAHHGVDQQTMEARAYAVARAFSPLLVNTVVGFIGPEYLYDGK
FT                   QIIRAGLEDHFCGKLMGLPMGCDVCYTNHAEADQDDMDTLLTLFGVAGIHFIMGVPGAD
FT                   DIMLNYQSTSFHDALYLRDMLGLRPAPEFEAWLQSMGIVDAAGRLQDATARQPLLQLAH
FT                   AL"
     MHFDHTIGAQ RHVFNDLKTL LAKASPSRSG DYLAGLAAAS EGERMAARMA LADVPLSVFL        60
     NEALVPYEDD EVTRLILDRH DAQAFQPIAS LTVGEFRNWL LLHETDSQTL ASVATGVTPE       120
     MAAAVSKLMR NQDLVAVARK CRVVTRFRNT IGLPGRLSVR LQPNHPTDDP KGIAASIIDG       180
     LLYGCGDATI GINPAGDNLG AIVSLLQLVD ELRNRYAIPT QSCVLTHVTN TVRAIDQGAP       240
     VDLMFQSVAG SEQANARFGI SLALLAEAHD AAQSLARGTV GNNVMYFETG QGSALSANAH       300
     HGVDQQTMEA RAYAVARAFS PLLVNTVVGF IGPEYLYDGK QIIRAGLEDH FCGKLMGLPM       360
     GCDVCYTNHA EADQDDMDTL LTLFGVAGIH FIMGVPGADD IMLNYQSTSF HDALYLRDML       420
     GLRPAPEFEA WLQSMGIVDA AGRLQDATAR QPLLQLAHAL                             460
//

If you have problems or comments...

PBIL Back to PBIL home page