(data stored in ACNUC7421 zone)

EMBL: CP001069.PE53

CP001069.PE53        Location/Qualifiers
FT   CDS             63979..64872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3815"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   rme:Rmet_6074 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3815"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28929"
FT                   /db_xref="GOA:B2UH78"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH78"
FT                   /protein_id="ACD28929.1"
FT                   /translation="MRYAFIERNRRYWPVSVLCELLGVSPSGYHQRKQRTVSTDRPDRG
FT                   RLSDDALLAHIKAIHAGVKGEYGWPRMWKELLARGVRVGKERVRKLMALHGIRARHKRK
FT                   YIATTNSNHDLPVAPNLLQRDFSPAAPNQVWTSDITYVATAEGWLYLVVIIDLFSRQVV
FT                   GWSMQPHMKAELVTDALRMAWFRRRPEAGVIVHTDRGSQYCSHLFQDALKAYGMRSSMS
FT                   RRGDCWDNAPTESLWGSLKVARLHGRQFATRRAAMDEVIDWLGFYNASRLHSTLGYVSP
FT                   MTFEKNWSAAQQHRAA"
     MRYAFIERNR RYWPVSVLCE LLGVSPSGYH QRKQRTVSTD RPDRGRLSDD ALLAHIKAIH        60
     AGVKGEYGWP RMWKELLARG VRVGKERVRK LMALHGIRAR HKRKYIATTN SNHDLPVAPN       120
     LLQRDFSPAA PNQVWTSDIT YVATAEGWLY LVVIIDLFSR QVVGWSMQPH MKAELVTDAL       180
     RMAWFRRRPE AGVIVHTDRG SQYCSHLFQD ALKAYGMRSS MSRRGDCWDN APTESLWGSL       240
     KVARLHGRQF ATRRAAMDEV IDWLGFYNAS RLHSTLGYVS PMTFEKNWSA AQQHRAA          297
//

If you have problems or comments...

PBIL Back to PBIL home page