(data stored in ACNUC7421 zone)

EMBL: CP001069.PE531

CP001069.PE531       Location/Qualifiers
FT   CDS             complement(610773..612170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4311"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DbpA RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: rso:RSc0622 ATP-dependent
FT                   RNA helicase DbpA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4311"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29407"
FT                   /db_xref="GOA:B2UIK6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK6"
FT                   /protein_id="ACD29407.1"
FT                   /translation="MTLEPTATPFSTLALAPAVLANLAQLGYTDMTPIQAASLPIALAG
FT                   HDLIAQAKTGSGKTAAFALALLARLDARSFDVQAMVLCPTRELADQVAQEIRRLARAEE
FT                   NVKVLTLCGGTPMRPQAASLEHGAHVIVGTPGRIMDHLERGNLALGALKTLVLDEADRM
FT                   LDMGFFDDIATVVRQCPADRQTLLFSATYPEGIAKLSQRILRNPKEVKLEERHDDSKIR
FT                   QRFYEVTDSQRLHAVGQLLKHYRPVSTLAFCNTKQQCRDLLDVLRAQGIHALALHGELE
FT                   QRERDQVLIQFANRSCSVLVATDVAARGLDIAQLEAVINVDVTPDPEVHVHRIGRTGRA
FT                   DENGWALSLASMDEMGRVGNIEEAMGREVEWHQLDELDTGNDAPLLPPMETLQILGGRK
FT                   EKIRPGDVLGALTGDAGFRGDQIGKINVTEFSTYVAVERGIARDALRKLNAGTLKGKKV
FT                   RVRLMDE"
     MTLEPTATPF STLALAPAVL ANLAQLGYTD MTPIQAASLP IALAGHDLIA QAKTGSGKTA        60
     AFALALLARL DARSFDVQAM VLCPTRELAD QVAQEIRRLA RAEENVKVLT LCGGTPMRPQ       120
     AASLEHGAHV IVGTPGRIMD HLERGNLALG ALKTLVLDEA DRMLDMGFFD DIATVVRQCP       180
     ADRQTLLFSA TYPEGIAKLS QRILRNPKEV KLEERHDDSK IRQRFYEVTD SQRLHAVGQL       240
     LKHYRPVSTL AFCNTKQQCR DLLDVLRAQG IHALALHGEL EQRERDQVLI QFANRSCSVL       300
     VATDVAARGL DIAQLEAVIN VDVTPDPEVH VHRIGRTGRA DENGWALSLA SMDEMGRVGN       360
     IEEAMGREVE WHQLDELDTG NDAPLLPPME TLQILGGRKE KIRPGDVLGA LTGDAGFRGD       420
     QIGKINVTEF STYVAVERGI ARDALRKLNA GTLKGKKVRV RLMDE                       465
//

If you have problems or comments...

PBIL Back to PBIL home page